SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0076706 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076706
Domain Number 1 Region: 425-481,1096-1249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.84e-33
Family Tandem AAA-ATPase domain 0.0042
Further Details:      
 
Domain Number 2 Region: 140-177,218-253,334-493
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.16e-27
Family Tandem AAA-ATPase domain 0.012
Further Details:      
 
Domain Number 3 Region: 1031-1087
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000153
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 4 Region: 272-323
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000017
Family PHD domain 0.011
Further Details:      
 
Weak hits

Sequence:  FBpp0076706
Domain Number - Region: 630-669
Classification Level Classification E-value
Superfamily TPR-like 0.000863
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Domain Number - Region: 625-704,914-959
Classification Level Classification E-value
Superfamily TPR-like 0.00257
Family Tetratricopeptide repeat (TPR) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076706   Gene: FBgn0035689   Transcript: FBtr0076998
Sequence length 1270
Comment pep:known chromosome:BDGP5:3L:6167348:6171877:1 gene:FBgn0035689 transcript:FBtr0076998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGVVLCEIADEVPPESPEDPTEFRYGKKRWVFKDNLVEHKEEILICIEKCQNARTRKLK
FRSIRQESGSCILVLSHEQTHVRAREIEMEVGEQVLPLFFKDFRGSLEFEVAQQEKEHKR
PLKTYVTTKLYDALYEKHRQTVHVEQERSLDLPKRFQSQLRKYQQRTVSWMLGREQQITQ
VPANFIVLHAIDGITRVFKHKYCLQFYPFEEEIPKISLPPGGILADEMGLGKTVEFLAML
LMNPRPQDSYRNDYWHQRLEEFSDEVPLKRSRISKKDEVFCICTKKHGKRVQCTKCRRWQ
HEMCMTISEKSDLPHLCPSCWSELVKSGERLVESGATIIVSPNAIKMQWFEEIHKHISPS
LKVLLYFGLHSTFWVSPFDLAQYDVVLTDYTILRNEIYHTTDFKSDRQMRHQQRYMRPNS
PLLMVNWWRVCLDEAQMVESSTSAAAEMVRMLPAINRWAVTGTIDELPPLLEFVGRPEVC
RPPDAWQTVDKAFQLNYKCEPLLELLEHSLWRTCKSKVEHELGIPPQTEVVHRLELSNVE
SLYYREEHLKCHEQFLAAVAKHTRHNADNSSCLASISPQLLRIILKPFLRIRQTCSVPVV
FNSNVSSTDYLHPQDLLARLKSNNENECKTELRTWASSYNGLAAIYFIKNDFPQAIKYYN
LLLKLANEYNEQNISVDSVLQIHAIYNLLQASSLAPAEHKLTELEHKKYQAQMSRLEWKY
LEDNTRVLESALSSYNENLEKVSELEKRFEGSTLDLLATMVNHKTSLHDAIWNKVRDDFF
RQNISVERLENVNSMAGMLYFMDIWHNKLQNLKSTLIAEFEFLKGVMQQACEAIKTGVLL
SMEIINFIENVTVCHLTDILDANKDKPVKPKKHRYCRLCLIRDSLNQFECLLFAKKLDEK
ATVTEGLENPSMEISFIKSIFAFLRSKQDFSEWKEECQSKLELLSCLQDLVKFQIKYWIE
VEYMVKAFDELEMCKMRILLTDDPEEQSNYRILACQLDEQLQFNQYNLQTSQLNFTRLCG
RLKYLKHLKEDSADKPCPICQTQDDVRYVMMVCGHFVCQHCLDSMRRKNGRAGVTKCPLC
RQDSPQLYYSVRPGAHKSIIGDFSTKISSVVELVLKIKGENEQEKIIVFSQWQAILIEIA
RALSLNGIQFRNKCTNKDFDDFKNPLSNVTCLLMPLSKGSKGLNLIEATHVFLVEPILNP
GDERQAIGRIHRFGQKRPTKVHRFIVNETIEENILSLITSADDTTTLSTHWDLENMTLDS
LKKLFILKEE
Download sequence
Identical sequences Q9VRV2
7227.FBpp0076706 FBpp0076706 FBpp0304173 NP_001261471.1.81976 NP_648034.1.81976 FBpp0076706 FBpp0076706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]