SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0076961 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076961
Domain Number 1 Region: 26-121,452-540
Classification Level Classification E-value
Superfamily TPR-like 0.00000238
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076961   Gene: FBgn0031142   Transcript: FBtr0077269
Sequence length 594
Comment pep:known chromosome:BDGP5:X:20894417:20896915:-1 gene:FBgn0031142 transcript:FBtr0077269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDSSQSAPAGLLVANLKSWETFDWPTEQQRWIYRSWGQYFARMRKNTFAQKYFDKCITE
NESTDHKALYLRSKFKRSVALTQDALEDSLRAMEVRQAWDANVSMELGDALYDLNRFEEN
KSLLHDNVRRHAGTALKSFENRLVVVDENLKDCTGFSLANFFMEHSAQLPGFYAHQQEEL
RRADRRPLWKILKERKECDVQSRIDRKEVMLSPLERERRRRKTKIFYQNYLGRSWTDFFF
LKTLRRHPNCLLDNHFGSSADRTKYLEYAFQRLKTFTRMLQARRPMYKEYFHRNPQIEAR
MRDANLFRIQYQTRRNMVSILRTIKVLRGRNDIKRLRKFVEEVMGSYVVIKTNRLMPWKA
EFMNEVYNNLALSLCEGYRLPPTRVTPYDKSAMCQLLNIPVAKPLEHTELIFGDRSTYSY
AGADKQSTDRLADQNQIEYLEKRLLFARLPIERSYLLHELADRHMQKNHFVQSLSYAQKA
IEEARVCNSLIWEFLSTMLMAKSHAVLHKYERQTEVLNSAYELAAQLKSPQLCTFIELCR
MLNKDYITLRKMSQLVTTKRLRTKISNRSSFLSSPNCSPNFSEFKKEEYGHLAA
Download sequence
Identical sequences Q9VRD3
NP_608419.1.81976 FBpp0076961 FBpp0076961 FBpp0076961 7227.FBpp0076961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]