SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0077790 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077790
Domain Number 1 Region: 174-298
Classification Level Classification E-value
Superfamily TPR-like 2.09e-46
Family Tetratricopeptide repeat (TPR) 0.0000205
Further Details:      
 
Domain Number 2 Region: 308-422
Classification Level Classification E-value
Superfamily TPR-like 1.75e-41
Family Tetratricopeptide repeat (TPR) 0.00066
Further Details:      
 
Domain Number 3 Region: 3-115
Classification Level Classification E-value
Superfamily TPR-like 5.14e-39
Family Tetratricopeptide repeat (TPR) 0.0000607
Further Details:      
 
Weak hits

Sequence:  FBpp0077790
Domain Number - Region: 414-461
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.0981
Family YqbF N-terminal domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077790   Gene: FBgn0024352   Transcript: FBtr0078131
Sequence length 490
Comment pep:known chromosome:BDGP5:2L:295109:297413:1 gene:FBgn0024352 transcript:FBtr0078131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKVNELKEKGNQALSAEKFDEAVAAYTEAIALDDQNHVLYSNRSAAFAKAGKFQEALED
AEKTIQLNPTWPKGYSRKGAAAAGLNDFMKAFEAYNEGLKYDPTNAILLQGRMETTASAL
SFMQSQGDIPMDVDPQQARSRRAPSPPPAKPAEPPKPAEPRVEDMTEEQKNKYFARKEKE
LGNAAYKKKDFETALKHYHAAIEHDPTDITFYNNIAAVHFERKEYEECIKQCEKGIEVGR
ESRADFKLIAKSFARIGNTYRKLENYKQAKVYYEKAMSEHRTPEIKTSLSEVEAKIKEEE
RMAYINPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDDPKLYSNRAACYTKLAAF
DLGLKDCDTCIKLDEKFIKGYIRKGKILQGMQQQSKAQAAYQKALELDPNNAEAIEGYRQ
CSMNFQRNPQEVLKNAMSDPEIQQILKDPAMRMILEQMQSDPNAVKEHLQNPAIADKIMK
LLESGIIQIH
Download sequence
Identical sequences Q9VPN5
FR706 7227.FBpp0077790 NP_477354.1.81976 FBpp0077790 FBpp0077790 FBpp0077790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]