SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0077927 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077927
Domain Number 1 Region: 312-384
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000261
Family PCI domain (PINT motif) 0.023
Further Details:      
 
Weak hits

Sequence:  FBpp0077927
Domain Number - Region: 195-226
Classification Level Classification E-value
Superfamily TPR-like 0.0333
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077927   Gene: FBgn0027055   Transcript: FBtr0078269
Sequence length 445
Comment pep:known chromosome:BDGP5:3L:20832194:20834675:-1 gene:FBgn0027055 transcript:FBtr0078269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSALENYVNQVRTLSASGSYRELAEELPESLSLLARNWSILDNVLETLDMQQHSLGVLY
VLLAKLHSASTANPEPVQLIQLMRDFVQRNNNEQLRYAVCAFYETCHLFTEFVVQKNLSI
LGIRIISRAIDQIRQLETQLTPIHADLCLLSLKAKNFSVVLPYLDADITDISTVAAECKT
QQQQQSQHADANNDAKYFLLYFYYGGMIYTAVKNYERALYFFEVCITTPAMAMSHIMLEA
YKKFLMVSLIVEGKIAYIPKNTQVIGRFMKPMANHYHDLVNVYANSSSEELRIIILKYSE
AFTRDNNMGLAKQVATSLYKRNIQRLTKTFLTLSLSDVASRVQLASAVEAERYILNMIKS
GEIYASINQKDGMVLFKDDPEKYNSPEMFLNVQNNITHVLDQVRQINKMEEEIILNPMYV
KKALGSQDDDLTSQHPKTFSGDPTD
Download sequence
Identical sequences Q8SYG2
FBpp0077927 NP_524190.2.81976 FBpp0077927 FBpp0077927 7227.FBpp0077927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]