SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0077934 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077934
Domain Number 1 Region: 364-457
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000203
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077934   Gene: FBgn0037022   Transcript: FBtr0078276
Sequence length 484
Comment pep:known chromosome:BDGP5:3L:20779439:20781234:-1 gene:FBgn0037022 transcript:FBtr0078276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHKISEYFANDPPSFFDELASKPKGNNLSTEGSSSSASSTSSAPNMMSNTFVGFFQPPE
YVETPEAGEDSIKVGDDVRNLWELPRENEPGKLIMPGIHLQTDLADPISVAVTQHLGEAE
LSYRKILRVDDVTQDERGLRTLIHAGCYRTAVNLTGRLLTIYGQGYGRSGQPAKHSPHSL
QLWFTRLALLAKLGEFELLNAEAEPFGQLTSPDVFYDFYPEMYNGKSGSIACFSFRLLLA
ELPIYLGKPHVALDRLSELHVTTREIKEHYLSLHNKAAEEFWQRRCERVLHSIINCGLMM
KKFSMIDDIMEGTLLKRSNLSKEDRRSLYSAWGRIYLQIGDIFGAEQKIAVSRRLREINS
APDLRDLVDKGLIAVAKNDFPEAYVIFQKALHLDTGNTMILNNMGVCLLYAGKLKDAINL
YERAINLNPQKSLNESLLVNLSTLYELESNNSKAKKYNLLRLINRYKPDLNISIEICLKL
QTIN
Download sequence
Identical sequences Q9VPB6
FBpp0077934 FBpp0077934 FBpp0077934 FR740 7227.FBpp0077934 NP_649255.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]