SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0078027 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078027
Domain Number 1 Region: 33-144,455-549
Classification Level Classification E-value
Superfamily TPR-like 0.0000000246
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078027   Gene: FBgn0037101   Transcript: FBtr0078371
Sequence length 579
Comment pep:known chromosome:BDGP5:3L:21558526:21560885:1 gene:FBgn0037101 transcript:FBtr0078371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSIIPPGSLVPQAQGVEAAVPVWFKMDWSPEIEQGIYKDWGTYYSRRRRENLGMYYFDK
ALKLGPADFTTLYRRSQSKRKNAQADGALKDSLEAKRLLKNLQRYDAPINLEVCDALYEL
NQLENAKAELHDNTRLFTGNKTKMFEQRLVVVDENIEDACGPSMTQYISDKEKLIVHLKE
VQNKYKPDTRPLWKILKEQEKCDVLSIPEIEEEMLSPLEIARRSRAFDVFNQMFIDRSWH
DVIFLKHVRKNPNLLLNQCKNSTEYLQTLSTKKYDEIKSFLKILEARSPMYNIRYQKFTN
KKLMDKFRQEYLFRVQYQTRRNMISALRSIRYLRKTKSLTKLTSYVEEVMGDYVVKKTNR
IMPWKFEFINEVYNILALAYVDQYTLPKNFRFSEKNALLRLLRFPMDKSKEVKHFVFGDR
TTHQGSETVDPALTKSRLMGNRLENRMNFAKYPIEKSYLLHQMAEIHLKSHRFDECCFSA
RKSIEEAKKCNSYIWQFLCYLLIIKANAALHKVERTSEALDLALKISKELKEKHIHNFLT
ACIHCNEEEFIVKKQSIFANSRRESEKSVYSSLSVRHSN
Download sequence
Identical sequences Q8T4A3
7227.FBpp0078027 FBpp0078027 FBpp0078027 FBpp0078027 NP_649332.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]