SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0078887 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078887
Domain Number 1 Region: 272-445
Classification Level Classification E-value
Superfamily Fic-like 3.79e-46
Family Fic-like 0.0031
Further Details:      
 
Domain Number 2 Region: 107-198
Classification Level Classification E-value
Superfamily TPR-like 0.00000000169
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078887   Gene: FBgn0263278   Transcript: FBtr0079257
Sequence length 492
Comment pep:known chromosome:BDGP5:2L:6424337:6426373:1 gene:FBgn0263278 transcript:FBtr0079257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTEAEQPSPPAQQQDQENPPLCKAQNPKPARLYRFVLIFVAGSLAAWTFHALSSTNLVW
KLRQLHHLPTAHYLQTRDEFALYSVEELNAFKEFYDKSVSDSVGASYTEAEQTNIKEALG
ALRMAQDLYLAGKDDKAARLFEHALALAPRHPEVLLRYGEFLEHNQRNIVLADQYYFQAL
TISPSNSEALANRQRTADVVQSLDERRLESLDSKRDALSAIHESNGALRRAKKEAYFQHI
YHSVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKIDITIK
DILELHRRVLGHVDPIEGGEFRRNQVYVGGHIPPGPGDLALLMQRFERWLNSEHSSTLHP
VNYAALAHYKLVHIHPFVDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSKYYHFLKLANE
GDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTESEAGERLAQMQSPNVAQRSSI
LEFYESGSGDLP
Download sequence
Identical sequences Q8SWV6
FBpp0078887 NP_609026.1.81976 7227.FBpp0078887 FBpp0078887 FR685 FBpp0078887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]