SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0079617 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079617
Domain Number 1 Region: 16-116
Classification Level Classification E-value
Superfamily TPR-like 1.61e-27
Family Tetratricopeptide repeat (TPR) 0.0000558
Further Details:      
 
Domain Number 2 Region: 206-286
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-23
Family U-box 0.0000514
Further Details:      
 
Weak hits

Sequence:  FBpp0079617
Domain Number - Region: 87-197
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0544
Family IMD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079617   Gene: FBgn0027052   Transcript: FBtr0080027
Sequence length 289
Comment pep:known chromosome:BDGP5:2L:10437551:10439244:1 gene:FBgn0027052 transcript:FBtr0080027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTKHIYSTTNLSDLQLKEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLK
LKRWELCCQDSRRALDIDGNLLKGHFFLGQGLMEIDNFDEAIKHLQRAYDLSKEQKQNFG
DDITLQLRLARKKRWNVMEEKRIQQEIELQSYLNGLIKGDMESRLANLKLNGNVHDEQLK
DKQQEIEQECDDHIKELNNIFSKVDERRKKREVPDFLCGKISFEILTDPVITPSGITYER
KDIEEHLQRVGHFDPVTRVKLTQDQLIPNFSMKEVVDSFIAENEWSLDY
Download sequence
Identical sequences Q9XYW6
7227.FBpp0079617 NP_477441.1.81976 FBpp0079617 FBpp0079617 FBpp0079617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]