SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0079665 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079665
Domain Number 1 Region: 679-770,828-1031
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.42e-42
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.073
Further Details:      
 
Domain Number 2 Region: 291-400
Classification Level Classification E-value
Superfamily TPR-like 5.69e-20
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Domain Number 3 Region: 110-249
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000464
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079665   Gene: FBgn0260749   Transcript: FBtr0080076
Sequence length 1136
Comment pep:known chromosome:BDGP5:2L:10272627:10277548:-1 gene:FBgn0260749 transcript:FBtr0080076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQLTFEDDCLIRELDSRYYGFLDLSNSKNAELRNLVQQTITNLQNYIANGQVHESKNSS
DNKNAIQKFEPSTQAGEHMENTSSRNNDDTKPFEQDAKEKVSIIEEKHQDEHYVNALCKL
GHLHLLLGEYSEALSAYQKYLRFRENNYWTNHAFIYGIGVAYFKLRCFKWAIKSFQELLY
LSPNFTCANEVHLRLGLMLKHCGEFHIALKHLQLALLYTYPSTFSELQVKFQIAHLYEVQ
NKHKAAKDGYEFLLNEKNISLELKADVYRQLGWMYHCVECLGEKKEREANALNFLQKSIE
ADPKSGQSLYLLGRCYAGINKVHDAFLAYRNSVEKSEGNADTWCSIGVLYQQQNQPTDAL
QAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQISFQKSSLIRKKQAIRM
KKDTIGLSKGLSQRITFLEGQLSQAPLPSITSKRRQLCSIEEAWNLPISLEMNSRQQQTA
QMLPRQVTKQSPVQGPPPPYPHSQLSQSPIPSKRIKEDGTSQQEVTQNNSQTSAQNLINI
SESLNQRNFNAMPESNKSSEQSVLDTFDDISNDIYKQNESIKLERLSQDALSNNEDSRHD
FIGGDNADISTTFKIQMDSKQLMVAVKLLPIDEPPVHCTILQVNAPPPSPPDCPPQKLTR
DQLLPPTPSVHLENKKHAFSPQLQEFCLKHPIAVVRGLAGVLKLDLGLFSTKTLVEANPD
HSVEVRTQVHQSPDENWDTSQGKRVWACISHRSHTTIAKYAQYQASSFQDSLKLILPQDE
SDKGFPGSQAMSDSDSKDSVSNSNIVLKRKKHKINSKMLRFGTNVDLSDEKKWKPQLTEL
QKLPAFARVISAANMLSHVGHVILGMNTVQLYMKVPGSRTPGHQENNNFCSININIGPGD
CEWFAVPDAYWGGVHNLCEKNNISYLHGSWWPVLEDLYKENIPVYRFIQKPGDLVWVNAG
CVHWVQSIGWCNNIAWNVGPLTARQYSLAIERYEWNKVQAFKSIVPMVHLSWNLARNIKV
SDTKLFELIKMCLLQTLKNVLHIQEYVKSKGVEIRFNGRGKNEASHYCGQCEVEVFNVLF
IKEQEKRHVVHCLSCALKLSPSLQGIVCLEEYRLSELQRVYDSFTLHRTQGLAYTQ
Download sequence
Identical sequences Q9VL07
FBpp0079664 FBpp0079664 NP_609368.3.81976 7227.FBpp0079664 FBpp0079665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]