SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0079851 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079851
Domain Number 1 Region: 882-1012
Classification Level Classification E-value
Superfamily TPR-like 2.22e-16
Family Tetratricopeptide repeat (TPR) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079851   Gene: FBgn0032369   Transcript: FBtr0080267
Sequence length 1058
Comment pep:known chromosome:BDGP5:2L:11645133:11648839:-1 gene:FBgn0032369 transcript:FBtr0080267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRKIRNTLRRTARLTKRRRSAGGNEISRNKAVEQRTVEIPLDQRQAPQQRVFLYIQLNE
MSKLPETGNPLELHLYHPKNTLQKMQERYTTDTIIYQHEFNLKKPVFAMGVMQDDIEDMN
TFSDQPLLISLYQRIPRRRKGGSGKGKSRKHGRTSSSREINQLITDALESKENVLKERSS
KWSSERDGEEGGEEGEGGTFSEERLELLSRGHCDLLQLFQRRRFISDITIYLYPEYRSKK
INDKMTTCSVWHMYSILPILKNFNFTNLAFLTLESIYNVPEDLHSKSAELGLSVSFRSTQ
PEESDGAFRVVPLCTYSGFISQIISDQNTIIVWENIKRDLHLNMNFSFNQMETNSRVKLP
KLFRMLLWEQDVDFQIHKIDPVSDLALINNSLHRFVLNEQMRKILEEAVVHNDYELLLQL
YQETPTNVLYEGVINPSIFGYPGVNYCRFACRLNPVFEPSIKLSLPRDTLVMGPMFCTFK
ICFFQPICERNEPLDQYNESLLKRAKLRRCFDMEFLKEDETDGDVLLELYRAFDDLITDT
IEFIIKRDVQDINDRKEFFCCQLGNICNLVLKICGCDFNVRMPTKTNIEFREMLTHMYKE
LMDRIEGVFTACCWKNNCVTTSNQDQEEHGLNRMMNEMRLVSNTGQRDLAIHMYDEIDHS
TTNRIVFDFVTLLNSVENLQFEQAARYFTKPRTTDWSGYYFTLILQLYINYMMDLRSTDE
EVVSTVKSNMIESLRQFANKNSLESEIWILLYCYYKEHSYLPGMELTRWKFQNLTKITPK
ALNYTPTSLYELYLPVDFEMKSSSTPMNTQFYPVFKLFARLGAYAFAEVIFSEIEQCFTE
AEVYLIRTTLKILQRQIDDKFQIIKMPTDNSVYGKLKRCYQLHINGSVEYSRGRCDEALK
YFQELLSVVDPMDNLLFKLSFLRLGQLALQRKQYELAEKAFNICLPARRKNFIANYGMGL
TLYHLNRLEEAIPYLSRCTEVDIFIPDVWGYLATINLRLSRNKTALECWKVAKLYPEVSI
SKSVYAELDKIQYSDVHLLVDDDGNPAEKMTKMDFIPL
Download sequence
Identical sequences Q9VKG0
NP_001285845.1.81976 NP_609511.3.81976 FBpp0079851 FBpp0079851 FBpp0079851 7227.FBpp0079851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]