SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0079893 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079893
Domain Number 1 Region: 303-539
Classification Level Classification E-value
Superfamily TPR-like 1.71e-28
Family Tetratricopeptide repeat (TPR) 0.0069
Further Details:      
 
Domain Number 2 Region: 89-186
Classification Level Classification E-value
Superfamily TPR-like 2.08e-23
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079893   Gene: FBgn0032397   Transcript: FBtr0080309
Sequence length 589
Comment pep:known chromosome:BDGP5:2L:12036003:12038543:-1 gene:FBgn0032397 transcript:FBtr0080309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMTLNIGSMKLTKWQLALILGTPLAIGLGTYAVKSWTAASKELDGEKKRPKAKIEKQAI
SLDGTAPDQELERNQKSAELGEKLSPLKEANNYKTEGNNCYRNGKYDEAIKFYDKAIDKC
PKEHRTDMAIFYQNRAASYEMLKKWSNVKEDCTASLEFNPRYAKAYYRRARAHEATKDMN
ECLDDVTATCILEMFQNNQTIMFADRVLKETGRLDAEKGMRNRVPVVPSACFVNTYTRSF
IADPLQTMKVPAPKSDAPPKGFLRAHLAFLEEKYEEIIPACTEEIESSEAEAQYKVEALL
MRGTFHLLCGSYVESQQDFDAIIANDYADPNLRAYAYIKRAALYIQLDQREKGIADFAEA
ERLNPENPDVYHQRAQILLLLEQIEPALAEFEKAVSIAPNHAIAFVQKCYAEYRLSLLAG
DQRRLESVMHTFQNAIERFPSCVECYSLTAQVLADQQQFTQAEEYYKKAMVLAPTNPALI
VHQAIMVLQWRGDINLAVQLLNKAIEVDPKCELAYETLGTVEVQRAQLTRAVELFEKALL
YAKSQAELVHVYSLRNAAVAQINVTKKLGIDMNSVSAMAQSGLMAQGVA
Download sequence
Identical sequences Q9VKC8
FBpp0079893 FBpp0079893 FBpp0079894 FBpp0079895 NP_609536.1.81976 NP_723711.1.81976 NP_723712.1.81976 FBpp0079893 FBpp0079894 FBpp0079895 7227.FBpp0079893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]