SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0080233 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0080233
Domain Number - Region: 136-272
Classification Level Classification E-value
Superfamily TPR-like 0.00109
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080233   Gene: FBgn0028838   Transcript: FBtr0080671
Sequence length 364
Comment pep:known chromosome:BDGP5:2L:14762765:14764065:1 gene:FBgn0028838 transcript:FBtr0080671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNGEETMLHLPSYADRYTDIPRLIRLKFIAQVCPELSVLALELALNHVKTTYNVKLYDE
LYKTLCVEVDRKYPNQSKGNEELHTTGGSEPSTSSGRGRVVVPYDSYWVEDNIMEATLML
QELDAELNFKKSNSGSSYVRRILEEIGDHHEKSGNLQMAVKFYARARPYCTSSENVINMF
RNLIRVSIYMENWWHVLTYIDEAKQYAYGFENLAQEVPARLSCVAGLAHLGLKIYKSAAQ
YFLSTPYGRYDYDKIVAPEDVTLYAGLCALATFDRETLQLNAINSEAFKPFFQLSPKMWT
ILAKFYAGEFDACMTLLREIENHVRLDVYLSPHVSALYDLIMARMLKKRNREVMTESVKK
RKSR
Download sequence
Identical sequences Q9VJR9
NP_609720.1.81976 FBpp0080233 FBpp0080233 FBpp0080233 7227.FBpp0080233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]