SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080387 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080387
Domain Number 1 Region: 184-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 146-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000513
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 7-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000884
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.082
Further Details:      
 
Domain Number 4 Region: 232-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000592
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 313-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000303
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080387   Gene: FBgn0028895   Transcript: FBtr0080829
Sequence length 413
Comment pep:known chromosome:BDGP5:2L:16300253:16301765:1 gene:FBgn0028895 transcript:FBtr0080829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYNIHKICRVCLEELHPVTSIYSTDFAMMPSVMLMQCAKIRVFKTDGLPSVICNNCIYR
LGVAFHFKQECENSDLRLRQYLGILESWRQDAATNTDFVEKPLLPQRDSDEEEPVDAKVS
KRRSRYQRKPPEEHKKRGPKPVPKMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFC
IQRFAQKYNLKVHERTHTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGF
YTAGDLSKHMITHTGIKNHHCDVCGKAFSRRRDMRTHKLKLHPLESSTNHDIVDDDDDEA
IDTDPVGLDTLDHAHFKCPDCDKAFDTADSLSLHFRTHAANNNLLNLPLPPAPPMSHHYH
HDALHHLGPPNPATQMGMAAMAHMLAPPPPPPPTPSEGRYTMLHHTAAQRLHY
Download sequence
Identical sequences B4Q6Z6 Q9VJL7
NP_609786.2.81976 XP_002079619.1.80810 FBpp0080387 FBpp0080387 FBpp0080387 7227.FBpp0080387 FBpp0222451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]