SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0080424 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080424
Domain Number 1 Region: 396-499
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.06e-29
Family Chaperone J-domain 0.00023
Further Details:      
 
Domain Number 2 Region: 48-144
Classification Level Classification E-value
Superfamily TPR-like 2e-26
Family Tetratricopeptide repeat (TPR) 0.00066
Further Details:      
 
Domain Number 3 Region: 280-398
Classification Level Classification E-value
Superfamily TPR-like 1.39e-24
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 
Domain Number 4 Region: 174-277
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000126
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080424   Gene: FBgn0032586   Transcript: FBtr0080867
Sequence length 508
Comment pep:known chromosome:BDGP5:2L:16496766:16507352:1 gene:FBgn0032586 transcript:FBtr0080867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDEVIEISDSEREETSSNSEMDVEITTEQPTIDVKAEQIVPKDAATIAEEKKKLGNDQY
KAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAY
VRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATIQANYDTKSYR
NVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSADAIYVRGLC
LYYTDNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYREAHVIY
TDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLELNSQYLKALLLRARCYN
DLEKFEESVADYETALQLEKTPEIKRMLREAKFALKKSKRKDYYKILGIGRNASDDEIKK
AYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRYDSGQDIEEQEQA
DFDPNQMFRTFFQFNGGGRNNSSFNFEF
Download sequence
Identical sequences Q9V3W1
FBpp0080423 FBpp0305671 FBpp0080423 FBpp0080424 7227.FBpp0080423 NP_001260501.1.81976 NP_523584.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]