SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0080741 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080741
Domain Number 1 Region: 248-407
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000297
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080741   Gene: FBgn0051798   Transcript: FBtr0081200
Sequence length 491
Comment pep:known chromosome:BDGP5:2L:19394160:19396190:1 gene:FBgn0051798 transcript:FBtr0081200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQWQNEVVRITRQVKRNLPHRNFREINFDRETIRQGITPLTYDEARRLKGPVFEALED
ELRRAGCTMLPEFLHCLATKENALFESLNIRERLSDDSELLYGMVDRLRDAELAVCLNKH
RGLKKCFGLFFETMQLLEPYRQKYAYALVALNEHIISLCRNIAGQEHDAAEYISRIYYIY
SMYLVNTGQRTSAINFLQIAMDLVRGHVWTAEVGMPAGSLTLHELVAQNLARQLLIQGKS
IVRQHPEDAVAMARRATVLIAEIGRDKNMEIFCDTFLERAYFLMEIGNFNSAQQCLEQIK
TQILACTEYRFVKLNIKYYLIQGQCSEIFEHVEKATSCYKRALRLSRLYTHRDLEAEILL
HLGKIFAKDTQMTSIAKKCYEHAKRIYVDFNDLHSRKMANYLQAKLMADEITPLYMAMLK
SSTTRYCAFFNLRQWKNRCRPFWKRLGDEIIKQETDSIYCLLDEEKEDPGHDVAPYDDID
LKTFKLAEGDI
Download sequence
Identical sequences Q8INW8
FBpp0080741 FBpp0080741 7227.FBpp0080741 FBpp0080741 NP_001260572.1.81976 NP_724182.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]