SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0080893 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0080893
Domain Number - Region: 160-285
Classification Level Classification E-value
Superfamily TPR-like 0.000138
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number - Region: 255-355
Classification Level Classification E-value
Superfamily TPR-like 0.00711
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080893   Gene: FBgn0051687   Transcript: FBtr0081361
Sequence length 715
Comment pep:known chromosome:BDGP5:2L:20450207:20452538:1 gene:FBgn0051687 transcript:FBtr0081361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMQKFFSVLLPDVKRELRRGIIECSKRGLLHSTKWLAEMHHGLADVHIDNEAPDEDRTF
SECQLEGIAPEEYSDYFLAKSYYDVREYDRAAHAVRNCESSVPRFLHFYSSYMAREKRRL
DSTTDQANLHEPNQMRDLADLLATLRMEYGKSRLDGYGIYLYGVVLKALNLNQAAEQMLV
QAIRLVPMLWSAYLELSPLIMEKKKLLSLQLGGHWMRHFFMAHTYLELYLNDDGLKIYED
LQASGFSKSIYLIAQMALVYHNKRDVDKAIELYQALLESASPYRLDNVDTYSNLLFVKEM
KTEMAQLAHKAVSINKYRPETCCVIGGHFLLSTRPETESQVALAKFNRIIDSTLERPPVA
VDYSGLPQLSSATLQQRFNLAYPELVNQQQQQQQQLQLQQHHQQHDATKQISSLQGNPRL
DRGTDAVASTPLTLQAPRTPATATEEQLDSGHPHDDADVVDHDDHPHHDEDNQTKRNDVH
YLLKQLNSFSDIEEIEIVDMKQRGQRPPMASSSLATMMPPPSPAPPASPSTQSHRLGPRF
ASSGDSSLVLPQHQFDDYLFESCHYLETNYFAATYRTAMVESSSHEFRPSTNSSSNSFEL
HEMEPPSVICKAGVPPPLVSSHPGHPGHPDHPPPRYQFEYQAETRLTTSGVQTELTVESL
AKMSNCSGSSSSSSATRAPPFFRCCYTPIDRWRERRQQQKSSSASSSAAQPPKNV
Download sequence
Identical sequences FBpp0080893 7227.FBpp0080893 FBpp0080893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]