SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0080967 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080967
Domain Number 1 Region: 27-144
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-24
Family Single strand DNA-binding domain, SSB 0.00076
Further Details:      
 
Domain Number 2 Region: 181-245
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.56e-16
Family C-terminal domain of RPA32 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080967   Gene: FBgn0032906   Transcript: FBtr0081438
Sequence length 246
Comment pep:known chromosome:BDGP5:2L:20924975:20926144:-1 gene:FBgn0032906 transcript:FBtr0081438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQYAMACVVAIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVNNYVKVYGTTRSQGGSKTLMI
FKLLPVLDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGAGASSGSGSIADFTASQSSAIV
SGLEPKQQAVFQAIKSNVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDAD
HFICTM
Download sequence
Identical sequences Q9VIH1
FBpp0080967 FBpp0080967 FBpp0305226 7227.FBpp0080967 NP_001260652.1.81976 NP_610077.1.81976 FBpp0080967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]