SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0081284 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081284
Domain Number 1 Region: 366-590,664-915
Classification Level Classification E-value
Superfamily ARM repeat 9.6e-34
Family Plakophilin 1 helical region 0.058
Further Details:      
 
Domain Number 2 Region: 9-129
Classification Level Classification E-value
Superfamily TPR-like 3.16e-29
Family Tetratricopeptide repeat (TPR) 0.0015
Further Details:      
 
Domain Number 3 Region: 87-126,156-266
Classification Level Classification E-value
Superfamily ARM repeat 0.00000345
Family Armadillo repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081284   Gene: FBgn0010812   Transcript: FBtr0081788
Sequence length 947
Comment pep:known chromosome:BDGP5:3R:3859027:3862374:1 gene:FBgn0010812 transcript:FBtr0081788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNTINSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAY
LKLGKYENAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTV
QPMLQRLHVVVEERSARNAKTSTKVKQMMDLTFDLATPIDKRRAAANNLVVLAKEQTGAE
LLYKDHCIAKVASLTKVEKDQDIYVNMVHLVAALCENSVERTKGVLTELGVPWFMRVLDQ
KHENCVSTAQFCLQTILNALSGLKNKPDSKPEKELCTRNNREIDTLLTCLVYSITDRTIS
GAARDGVIELITRNVHYTALEWAERLVEIRGLCRLLDVCSELEDYKYESAMDITGSSSTI
ASVCLARIYENMYYDEAKARFTDQIDEYIKDKLLAPDMESKVRVTVAITALLNGPLDVGN
QVVAREGILQMILAMATTDDELQQRVSCECLIAASSKKDKAKALCEQGVDILKRLYHSKN
DGIRVRALVGLCKLGSYGGQDAAIRPFGDGAALKLAEACRRFLIKPGKDKDIRRWAADGL
AYLTLDAECKEKLIEDKASIHALMDLARGGNQSCLYGVVTTFVNLCNAYEKQEMLPEMIE
LAKFAKQHIPEEHELDDVDFINKRITVLANEGITTALCALAKTESHNSQELIARVLNAVC
GLKELRGKVVQEGGVKALLRMALEGTEKGKRHATQALARIGITINPEVSFSGQRSLDVIR
PLLNLLQQDCTALENFESLMALTNLASMNESVRQRIIKEQGVSKIEYYLMEDHLYLTRAA
AQCLCNLVMSEDVIKMFEGNNDRVKFLALLCEDEDEETATACAGALAIITSVSVKCCEKI
LAIASWLDILHTLIANPSPAVQHRGIVIILNMINAGEEIAKKLFETDIMELLSGLGQLPD
DTRAKAREVATQCLAAAERYRIIERSDNAEIPDVFAENSKISEIIDD
Download sequence
Identical sequences Q9VHW4
FBpp0081284 NP_001303425.1.81976 NP_524796.1.81976 FBpp0081284 FBpp0081284 7227.FBpp0081284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]