SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0081398 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081398
Domain Number 1 Region: 61-96,273-351
Classification Level Classification E-value
Superfamily TPR-like 0.000000198
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081398   Gene: FBgn0037624   Transcript: FBtr0081915
Sequence length 492
Comment pep:known chromosome:BDGP5:3R:4573528:4579827:1 gene:FBgn0037624 transcript:FBtr0081915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEAEAIVTTATADVSSPSKTVAVEPVAADTTPDNAPAVSTEGSGKAEQERAEKILKGK
ELFSQGSRNFLVKSYDEAADELSQVCQLYEEVYGELADELGQPLLLYAKALIAMALDENK
VIDVPDEAADDDDEDVDDDEEESAEDGAAKKEEKKDTKEAANGASSSNGKELDTIKEGSD
EADSTGEAEQAQSDEKPSKKVPTGVDEVSSSNGGGGAAVNDDERPSTSNGEVTASCSNGA
APAVEEEPEEEEGVSGSLQLAWEILEAAAQIFSRQGLSGLPYLAEVQTELANIEFENGIL
EAAREDYEKALKIHGELPTRNRRALAELHYKIGLTYLMQQLNKEGATALRQSSVLIEEEI
AEIKGKDEPSERDRNNMLDLEETKQEILAKIQEIEEMQAQTIAEVRAALDSYIKPMSSGD
AAAASSSSSSSANGAASSSSSSSKGAAAASSSTISSSSAKPTDITHLIKRKKPEDPSSEA
EALCSPAKRAAV
Download sequence
Identical sequences A0A126BEE6 Q9I7K6
FBpp0081398 FBpp0081398 7227.FBpp0081398 FBpp0081398 FBpp0301016 NP_001246993.1.81976 NP_649828.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]