SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0081756 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081756
Domain Number 1 Region: 34-270
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.05e-58
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 338-648
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.65e-39
Family Extended AAA-ATPase domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081756   Gene: FBgn0017577   Transcript: FBtr0082279
Sequence length 733
Comment pep:known chromosome:BDGP5:3R:6614250:6616872:1 gene:FBgn0017577 transcript:FBtr0082279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGFDDAGVFFSDNFGGDNQQDAQINLQAVKKKYKEFIRTFNEENFFYKYRDTLKRNYLN
GRYFLEIEMEDLVGFDETLADKLNKQPTEHLEIFEEAAREVADEITAPRPEHEEHMHDIQ
ILLSSNANPTNIRQLKSDCVSKLVKIAGIIVAASGISAKATRMSIQCLSCSTVIPNLKVN
PGLEGYALPRKCNTEQAGRPKCPLDPFFIMPDKCKCVDFQTLKLQELPDFVPQGEIPRHL
QLFCDRSLCERVVPGNRVLIQGIYSIRKVGKPSRRDGREKAVVGVRAPYMRVVGITVDSE
GAGAISRYSNITSDEEEHFRRMAASGDIYERLSQSLAPSIFGSRDIKKAITCMLFGGSRK
RLPDGLCRRGDINVLLLGDPGTAKSQLLKFVEKVAPIAVYTSGKGSSAAGLTASVMKDPQ
TRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCS
VLAAANSIFGRWDDTKGEENIDFMPTILSRFDMIFIVKDIHDESRDITLAKHIINVHLSS
NKSAPSEPAEGEISLSTFKKYIHYCRTHCGPRLSEAAGEKLKSRYVLMRSGAGQQEKASD
KRLSIPITVRQLEAVIRISESLAKIRLQPFATDEHVNEALRLFQVSTLDAAMTGSLAGAE
GFTTEEDQETLNRIEKQLKRRFAIGSQVSEQNILQDFLRQKYEERTVMKVIHTMIRRGEL
QHRMQRKMLYRIC
Download sequence
Identical sequences B4HIQ0 B4QUP5 Q9VGW6
7299365___KOG0481 FBpp0081756 7227.FBpp0081756 FBpp0081756 FBpp0217111 FBpp0205374 FBpp0081756 NP_524308.2.81976 XP_002031711.1.34323 XP_002103949.1.80810 FR539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]