SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0081805 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081805
Domain Number 1 Region: 302-420
Classification Level Classification E-value
Superfamily TPR-like 7.32e-18
Family Tetratricopeptide repeat (TPR) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081805   Gene: FBgn0037855   Transcript: FBtr0082329
Sequence length 872
Comment pep:known chromosome:BDGP5:3R:6715490:6719252:-1 gene:FBgn0037855 transcript:FBtr0082329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFDYIGQALGYHGQPLQKIWDDERGVDDLRLMGLTQVNYGVYQERQKYFTFQERAKRLK
MHQFLARKATDLYDRTLVANVMEDSLLAQGNTYMTQMAPFEFFLNVKDKRKGWAHRLSAL
KQGDIIYTQVTRLASGNRLIVKPLCTAEPKHAYLADIPIKAVILQDFWGPLPLDKQGNPR
SFVQNDILRCEINNISADTERLSLNMIGMFNKVPDLKFGLCDFKELPKYYSKIHNLDHPS
ASHYEDELNKALEFENPNYDLLFQMNGLQPNENLSLMSYLRAGFPEEENAAELRQKQASQ
WAFRSVADGIEHFKNGQQVEAFQCLNKALNIDPRNVEALVARGALYANRGSFLKGLQDFE
KALHLNKYHVNARKYMGETLVALGRSYEEENRIAEAVKAYSDCLNLLPLHEEARQSLDAL
HRSGDGKRRISTEPSNMTGGQSSDESSSSSASDSECEDSAGKPKSNISQPFYAQHKLKQS
GDEKLAVIDAHKANEFRLDDDETVSSVRKLLREASKHKKAKKKGKKKKDKKERRRSRTKS
ETEDPIELLKKIDFQEALRQDNKLMNSTRSDEERKAKIKSYLKEGGKESPPPPPPMKKTA
VSSRKSSFDNVGPSTSRHAASVVGFGGAQPPPAPKFLGQKKHPEPAPKLSFQIKKRPLQM
DKLGMLRLAAPAEPLKGGRSSSSRSRSRSRSRSRSRSRNRRLGRSTRSSLRSRRSGSRSR
SISRSRSRRRRTYSRSRSPSPRSYGNRFVIGRYRNRRTRRSRSFHRRRSPSPILKRRSPS
PFVPRRTPSPASRYRRSRSRSRSRSRSRSPRRFQSRYMPRDRGSVNRSRYSWHNPHKRSV
SRTVEPNGKDERAATPPKKGVADDRSGREERA
Download sequence
Identical sequences Q9VGU5
FBpp0081805 7227.FBpp0081805 FBpp0081805 FBpp0081805 NP_650036.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]