SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0082071 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082071
Domain Number 1 Region: 246-452
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 3.36e-46
Family ATP-dependent DNA ligase catalytic domain 0.00022
Further Details:      
 
Domain Number 2 Region: 462-604
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-32
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00028
Further Details:      
 
Domain Number 3 Region: 36-227
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.000000000902
Family ATP-dependent DNA ligase DNA-binding domain 0.03
Further Details:      
 
Domain Number 4 Region: 715-802
Classification Level Classification E-value
Superfamily BRCT domain 0.0000442
Family DNA-repair protein XRCC1 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082071   Gene: FBgn0038035   Transcript: FBtr0082600
Sequence length 806
Comment pep:known chromosome:BDGP5:3R:8224733:8227535:-1 gene:FBgn0038035 transcript:FBtr0082600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSRLTWQARILTRLLCNKMASKGLHNEDNKLDTFRRICDEIAGESSYLKKAERLQRFF
EKGSSGKGFKGDTVLWVQFLIPAANQRVYNLQNKALIKLFSRIFNADQQQMHLDLEQDGD
VSETLRKHFAASKKLKPQKQSKLYLQEVEEMLLHLVERTKEDEQTDLLQKLCSKATDLDL
RTFIRLVKHDLRINARARHILDAFGPDAYPAYQSSRDLVAIVEQFATKENKNYASSPVKK
TKKTSSSAIQVMTPISPMLASPCKSVEDAFKKSPTGLYSEIKYDGERVQIHKQGNDFKFF
SRNLKPVVDHKIRALKKYIPQAFPGGGEMILDSEIILVDTDTGALLPFGSLGAHKKQTFA
NAAVCLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTRELAAMT
ARVLHANLEGVVLKSPTSTYQPGKRNWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGG
TLSIFLMGCYDAFGRLWKTVTKVHSGLDDATNAEVHKSLIKLTERADANAIPSWLLCSKS
LVPDVLAKDPMKMPVWEITGAEFTKSDAHTASGISVRFPRITRRRSDKSAKEANDLAHLE
DLFEASKSNVNVDLLLANCSKDETAMNNKTTPEKEKKLNGNQSNGSKKLKRSNTGSDDED
GAPVLSKRKESKAIRSLSPSQKGLKDFFKPSKEFKSVVKKEPKEDEGNIESTSSKPQLFE
GLVAHFAMEKDSSKLMQQFSQHGGCCTTEPQKADLVFYANTNEALDLEKLRTLYRRSCRH
LNVSWLQSCLDTQSRQPFPLHAVMMK
Download sequence
Identical sequences Q9VG84
NP_650187.2.81976 FBpp0082071 FBpp0082071 7227.FBpp0082071 FBpp0082071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]