SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0082419 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082419
Domain Number 1 Region: 77-153
Classification Level Classification E-value
Superfamily TPR-like 0.000000011
Family Tetratricopeptide repeat (TPR) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082419   Gene: FBgn0038246   Transcript: FBtr0082960
Sequence length 374
Comment pep:known chromosome:BDGP5:3R:10435371:10444709:1 gene:FBgn0038246 transcript:FBtr0082960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNLLYMDKSNGNGVYAVRPNSSNGHMDNDNGLNGSGAPATTSTTTGTATAAGAALMATA
NNINIMNGAAAAAAASASGLPTSASSEDLSQSLSEYTDADESVSAPTEFLAEFLSAVMLK
DYKKALKYCKLILQYEPDNATAKEFYPLILDKLRAVATSSDSDENYNKSSSPDLALDLHA
SDVEADVDGDEAGDADEDGDADADGDGSESSNNCSEEEDNGWGDDEIDNVDVMDGEEESS
SSGDDFDLPIDDAGQDPAALAVHVHHSHTHSHSHSHNDSGSSRNSSSGGGGRSDNTTHSY
SSLLLEEEDDIVPVSLNFGLKENTAADLDVSNGNKVPSASCSDSESPTEPLTQRLAAILR
SKCGVSGGGSDETY
Download sequence
Identical sequences Q9VFH8
7227.FBpp0082420 FBpp0082419 NP_001262573.1.81976 NP_650376.1.81976 NP_731925.1.81976 FBpp0082419 FBpp0082420 FBpp0306145 FBpp0082419 FBpp0082420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]