SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0082545 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082545
Domain Number 1 Region: 430-703
Classification Level Classification E-value
Superfamily TPR-like 1.21e-43
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082545   Gene: FBgn0038324   Transcript: FBtr0083089
Sequence length 705
Comment pep:known chromosome:BDGP5:3R:11176949:11179648:1 gene:FBgn0038324 transcript:FBtr0083089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDLVHKATLHSMVCQAILVLICLLCYGCGGLSGAKFVFDDTVAIVKNRDVNSLPTNWTA
IFTHDFWGASLLSSDSHKSFRPLTTLMFHCEYALLGLSAAHMKFLNLLLHCVNTLLMWRL
IRSLYVPEVSTARWAILSAALFAAHPIHTEAVSGVVGRAELMFGMIHLLCLLLTVANTGR
LGPQTGGLIMLLTAVGMLFKESAVTIPMSCVLLDYFQNGYYHLRFKDQWSLLRTRISYLF
YLLGTLGLLTARLWWQDFETPTFKEVDNPVAHNEHVLTRGLSQQYLLVMNIWLMLCPHWL
CYDWALGCVKLVTNIWDLRLQGVIGFYSIVLVALMNFRRLPGMMLALGLMIVPFLPASGI
ICVGFVIAERTLYVPSIGFCLLSIYGFLYWYDSSTENTHWRTALRILLMLLFSVMMVRTR
QRATDWLNEEQLFKSALQVCPDNAKVHYNIARLATDMGNNTKAFQHYHRAIELYPNYESA
LMNLGNLYREHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALK
YRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDNKGLQDDAL
RISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTLYHTNLGVLYHR
WDKTQEAIEAYRTAISISAARATTARENLSKLLKRLEREAQVMQR
Download sequence
Identical sequences Q9VF81
7227.FBpp0082545 NP_650451.1.81976 FBpp0082545 FBpp0082545 FBpp0082545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]