SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0082592 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0082592
Domain Number - Region: 471-536
Classification Level Classification E-value
Superfamily TPR-like 0.000135
Family Tetratricopeptide repeat (TPR) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082592   Gene: FBgn0038303   Transcript: FBtr0083138
Sequence length 1145
Comment pep:known chromosome:BDGP5:3R:11040471:11044596:-1 gene:FBgn0038303 transcript:FBtr0083138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIKPIITYSGSCPLFRSLESQILNAIPLDTCEWRRTFQRPTKHVRLEAQAQQFNVAALE
KYKQGDWSILEHPILHIFVTECNDVDTYKATIREAIDIWLKTLTSYGVSDWMILLVETLD
MRKTKNFMPRTTVLDKIRLDFGTKNDDRCISVLNPAKFEQKSTESFRCLVQRIRFLMLTS
YNRNIVKYEELIRSKREKRNIEGWDFRQYFFMQEDLALIFEKLELPTEALIQYDELDAMF
SQFITHTGLNEKQQWLNHFRKPLDAFHGICLTRADKFEMRNKIRDEGVSLLEFRNYLFER
QAYLLLTCNDIPEIAKRLLNFLFSTLREVELIKLECQEGALCCWEFVCALEVLQLCEQAM
EPNELTCFQHCAPIWNLAKDKLYELGKLCGLLPGCTPTSEQLHIVVQLSSGIGDAPSEQH
QFLQATPQLRDRSPNRKPKKSGAEQLKEALGSNQAFQKLYLELAELAISTYKHVTRLRSA
RLVGLDLGNFYCALNEPHKAVGFFTDLLRELKAENWHMLSSQTLLELANCYRKMGDSLAY
TKTCSSISCCAELETLVRTFYFDEFLKSLKTLKTTLSAQPSIENANYCVLEDHFRILDIE
VVNQKPIIQDDYILVQLKVESLYPRGVVAENVKLCYELEASSLELAMENVSLTASPSTVK
AKDTSSRLKVSLQLVYKQDNRLHSAAVACDLPKSKQPVRRTSSTKRKLSPSVQADFTNFV
QAENIALQPGVNLIEMKAKATRVGCWQFKQLCISMSSLEFLSEQLPFMPATFEISTKPAS
ATLEFKTLIAGIVQPISLNVSGGSFIFPPDAKITLRCSKNLRIRQARNTDDEAAYNDDQS
FESTLQVPLVQFKSFEERRIPLEVLTDMPGRKVSKHHEHHIALNCPWSRTELPIAVDFQP
AMEATCRLHTCGTQKFLQVIMKGMEAHLLLQHAQVKCDVPGVQLLDLNPESQQPIEIYKS
LTVTYLYEIQVEPLKTEHELPVVKVHFVIKYASLSQPDVWRTYGCAFDLVDYTTLFKLQA
QLEPNELCRLRTVCNMNLKITKVHENPYTDLMYEVLNDQNLWAVCGRSAGVVSMKDVDSH
SISLDVMPLSTGFLPMPSIRLSKYTAGGKSKTDGHSKVHPFPPGQVYNSTKSMQIHVIAS
VAGDQ
Download sequence
Identical sequences Q9VFB7
NP_650431.1.81976 FBpp0082592 FBpp0082592 FBpp0082592 7227.FBpp0082592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]