SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0083238 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083238
Domain Number 1 Region: 24-151
Classification Level Classification E-value
Superfamily TPR-like 6.75e-16
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083238   Gene: FBgn0243511   Transcript: FBtr0083829
Sequence length 948
Comment pep:known chromosome:BDGP5:3R:15847425:15852207:1 gene:FBgn0243511 transcript:FBtr0083829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQQGMDSALFERRLRPVYDNLEVGNNRKALQESEKLLRKHPNLLCARALKGLSLLRLG
RYDESHGCLQTVAEEKPTDDSTLQVLSFCYREMEQLDKIVELYQHAVKQNPGNEELLAHL
FISHVRVEDYKAQQAVALQLYKAQPKNAYYFWSVISVVFQGIRGPESALPEKRKIYLGLA
QRMVDKHIKEGKMETEQEAFLYLHILKLQNKYQEAWEFLTGELCAKLYPGAPVSMKFELL
KELGNWRELNELLQQLLDADRDRWDFYKEYIQSSFELLKLTPQGVENGDKDSLARCQEFL
QRIIDSSERKKRGPYLARLELHQRMRAEQLPAEKLIGDFDEMVIEYFRLFGDKSCCTHDI
ALFLPSISMNQRQALASKLLLESGVTSTSLPKNKEQLQKHLCALQISRMCGSHMDLPADH
LLAFYTALKLHYEHGRTTFGKKLLATEMGPSDAYALLAANVMYDLSRRENKSDHLFEALC
LLQYVLRNSTSNFHVKLLSLKIYHLFGCQVGAQEMYEYLDIKQIQLDSMGYVHCQLLALG
GRFSGNRNVYDATLKFFTNSYKERLEYIALTYRFCTFSKMEEFMNFKERLTNSLQYVACS
VEAQICDLVSCYGNITQNLSAYVAMSIEPAEDRIAWHELSDNRDLGAIIRWDPLHEVDAA
EERRESFDQEVEVLQVRSLMLRLFASFIDLYHGAGLKDSPAGAETATLELLRESWTGLFQ
RLRVMNYKPLAQKFLVNLLPTRLHLLLDMPYERFFDDLAQLVLDLQSGSAKLAEQCKRVG
DNVIATMELCVQTINESNESNGIDGLWKRRGQQQKVAASLEMLSLYAFLLSVLNDKLQVS
SKTKTKKKPVENKVDGPQPISEKERSQMLQELMRQLKHKFEACDTAIRSWKAPVLPRDLS
SFMSDMSLKPEVEATLIGDVSATFKDSHELMVTELRNLLKDKIRMVAK
Download sequence
Identical sequences Q9VDQ7 U3Q053
FBpp0083238 NP_650858.1.81976 7227.FBpp0083238 FR704 FBpp0083238 FBpp0083238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]