SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0083319 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083319
Domain Number 1 Region: 20-201
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000847
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Domain Number 2 Region: 223-254,299-477
Classification Level Classification E-value
Superfamily TPR-like 0.000000143
Family Tetratricopeptide repeat (TPR) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083319   Gene: FBgn0038810   Transcript: FBtr0083911
Sequence length 650
Comment pep:known chromosome:BDGP5:3R:16414437:16416762:1 gene:FBgn0038810 transcript:FBtr0083911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKDANPKEALIKAAYADVNKFGNNQEFDKAVKAVNRILGVAPDDPTALHCKVVCLVQLS
KFEEAYKFIEKNRLSSLFFEKAYCEYQLNKQQQALKTIDDAGLQPLPPNLKELRTQVLYR
LERYDECLDSYRDIIKNTSDEYEEERRTNLSAVAANLAVDQTKEVPEVPEDTYEQYFNSA
CIQANRQKYAEAERKLRTSEKLCLEDECASEEEIIEEVDVIRVQLAYVLQLQGKTKEASS
IYADCLRHKPKDAALVAVASNNLVVVNKDQNVFDSKKKIRAALADACESRLTSRQKQVIA
LNNCLLALYTNAGDQVQQLSQKLAQTYPQVEFEALLIRCTQLAKDRKHKEAIEQLQKFAA
AHKSHEFVSKFAIIQLQLLQGNRKDAIETLLSLGEAKYKPGVVSALVSLYLGTDNKTAAS
ALLKSAVDWYKKNEVSSGDLSDMWRQAAEFHLRGGASETAASSLEELLKLNPNDTKVLAQ
LVIAYAQFQPKRALELSRKLPKLETLTTASEIDALEAANWVMSAKAAKKTANTKVEPSPS
TPLEKKKNRNRKRKGKLPKNYNAEVAPDPERWLPKYERTGFRKKRGGARGKDVIKGSQGM
ASGAADQYDMSSRVNLTKNSPATPVYQETAPGPRQQHRKGGHKKKKGGRF
Download sequence
Identical sequences Q9VDK7
FBpp0083319 FBpp0083319 NP_650898.1.81976 FBpp0083319 7227.FBpp0083319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]