SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0083670 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083670
Domain Number 1 Region: 177-519
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 2.88e-71
Family Tex N-terminal region-like 0.00018
Further Details:      
 
Domain Number 2 Region: 522-672
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.06e-37
Family Tex RuvX-like domain-like 0.0000833
Further Details:      
 
Domain Number 3 Region: 673-760
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.56e-23
Family Tex HhH-containing domain-like 0.001
Further Details:      
 
Domain Number 4 Region: 852-937
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000373
Family Cold shock DNA-binding domain-like 0.0013
Further Details:      
 
Domain Number 5 Region: 769-848
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000004
Family Tex HhH-containing domain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083670   Gene: FBgn0051156   Transcript: FBtr0084277
Sequence length 948
Comment pep:known chromosome:BDGP5:3R:18434392:18439374:-1 gene:FBgn0051156 transcript:FBtr0084277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKRPRRAASTKKIVIEISDSDEEVNLTADDDYRPEETKSRIIDRAADAQTVVTKRQRFP
TSKKTAAEGPAPKKKRGDKEKADENACPNENNPESVVQDTPSTSNQRNGAVGTEHNSEAP
APKRKRARKDKEDLKTAANETNPEKGDVVPSTAVTQPNDIVASSSHNKSSTGRSSFWERR
KVWNIDELLAETESIQPQAARNIVKLFEDENTIPFICRYRRDLVDHIAPDRLRDIRNTYT
EIVDLRKRAENIIGKLQRENIMTPEIREELMCAKSNEELEFLYAPYKPASKGTLAERAKA
LGLQVYADCLLYGSAPKVNLSEIVDRRNEALATEALVMSGICQIIIHNISKNTNVLEEIR
RLQNVHRVFLKCSKTKEAKSSKSSSSSKASSSKGSNQNADKKLDSSKFENYFNFQGDVKT
IKPYQMLAINRGEKHKWLSVKIETNDYLKRDLMRYITDQYMNQGLQYPLRREVFTKSLEE
CYAKKLQPLMCRQIRAALKEKGTKAAIDVFAKNLKQLLLISPLKGERILGIDPGFINGCK
LALISETADVLYTGVIYPHGAMSNKRAAEQKLVQLLSDHNCKIIGLGNGTACRETEHWLT
GMFHAGVLDSRIIRYSIVNENGASIYSCSNVAAKEFPKMDTNERSAVSIARRLNDPLSEY
VKIEPRHLGVGMYQHDVPEKILTASLNDVVSECVSYVGVDLNTASLSVLKHIAGLSEKKA
EKIIEHRTQKGPFKTRKDLLSVRSIGEKSFVQCAGFVRIEPRSVGGQLQNPLDCTWVHPE
SYNVVESIVGECDLKLSDVGKAAFIASIKQFASSQPNLDRIAKQHKLPMERLEFLLVALQ
RELLQDYRADLDKRPLFKQGLTRLDDLSMGEVVTGAVTNVTQFGAFVDVGVERNGLIHNS
NMNNSQLSVGDRIVASVVKVDLKRRQLELRLENMLMETDTSFKFKAED
Download sequence
Identical sequences Q9VCX7
FBpp0083670 NP_651070.3.81976 FBpp0083670 FBpp0083670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]