SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0083769 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083769
Domain Number 1 Region: 401-642
Classification Level Classification E-value
Superfamily TPR-like 3.5e-25
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Weak hits

Sequence:  FBpp0083769
Domain Number - Region: 18-109
Classification Level Classification E-value
Superfamily TPR-like 0.00114
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Domain Number - Region: 151-190,347-409
Classification Level Classification E-value
Superfamily TPR-like 0.00588
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083769   Gene: FBgn0025781   Transcript: FBtr0084377
Sequence length 718
Comment pep:known chromosome:BDGP5:3R:19106955:19109845:1 gene:FBgn0025781 transcript:FBtr0084377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGDTENTSTDTTNEHIDLALYRQLVKQFIDMRRYSTALFWAEKVAVLGGLEPRDIYYQA
QCMYLLGEYHRAAHTIQHHKLEKNSLPCFNLLLESLYAAKEFTEAANVIQNVEVEVMTTS
LINQPVDASSGCYLESNSVFGGEENHRNELLSSIYLMKGKVYEALDNRGMAMDFYVQALH
KSIYCFEALEALVQHEMLMAWEEFELMHHLPLAQQSSEADAKFILKLYESRLKKYYELIS
ARNAEEMSPIVNPDILQFIKEFTARVQQSGSSDTQMPKVSAVKVPLTPSQFMSPAQKVLE
DLKAPTFSLQTSLSKASSLIDASHRSMFDSSSRRRSRDHDTDTLIPIAECLDRVQRSTDL
MAAEAEKCFYDCDYKQCLKILNELLKVDPFHNTALTIQIACLVENGDFNRLFYVAHKLVD
RYPDKAISWYAVGCYYDMIGKSDPARRYLSKATALDRLYGPAWLAYGHSFANENEHEQAM
AAYFKATQLMRGCHLPLLYIGVECGLTKNLELAEKFFLQAMNIAPLDVYVLHELGVIKYE
YEFFDGAATIFQCTVDIVKQRAKSNNEEISSRWEPLFINLGHSLRKVHKYEEALYNFQYA
LLLKPQSPTTYTSIGFIHALLGNLDPAIEAFHKSLALNRDCIVTSTILKSCIEDLMDDSA
TIDEICSAALRDVAKNITANSRRVLNSDKFNGMKLKFDEEEEFANSDSNMVVEMSFDT
Download sequence
Identical sequences Q9VCN6
FBpp0083769 FBpp0083769 FR727 FBpp0083769 7227.FBpp0083769 NP_477397.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]