SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0084254 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084254
Domain Number 1 Region: 416-475
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000265
Family UBA domain 0.021
Further Details:      
 
Domain Number 2 Region: 71-164
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000182
Family Ubiquitin-related 0.022
Further Details:      
 
Domain Number 3 Region: 325-391
Classification Level Classification E-value
Superfamily UBA-like 0.000000000187
Family UBA domain 0.038
Further Details:      
 
Domain Number 4 Region: 470-515
Classification Level Classification E-value
Superfamily UBA-like 0.00000681
Family UBA domain 0.024
Further Details:      
 
Domain Number 5 Region: 212-345
Classification Level Classification E-value
Superfamily TPR-like 0.0000911
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084254   Gene: FBgn0039343   Transcript: FBtr0084880
Sequence length 614
Comment pep:known chromosome:BDGP5:3R:21331997:21334001:1 gene:FBgn0039343 transcript:FBtr0084880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQINNIFIKLRARLRERDIKLWEEPYYFEEVGSIESEMDRLARDISGELGISVSDCRIA
LGELQDGALRKLAARREFNDTGLATFNVRCVDSKGGTVQMLEIKCSLGGLGSDLQAEVAK
KLDIVDSSHVKCISGGRIINGQKTLASQGLKTNQHLMVVVGGTNEGQELHERIQRIRADL
ELVADADRFMEMEDQDGRPIFLPREENRSLLMAMSMYEVARVAMHKENFDEALLILLEAD
ELFSQCDSKLLEGVDNYALINLDIVWCYLRLKNITQLPDAQRRLDICERGFVKSYGEQFI
RLFSIKGPSSPERALIMRLHLLQGVLLFHQNRRDEAYEKLEVATKDLYEVKMNDTELSTL
VEMGYEESDARLALRSCAGQVDRAIQYIQERSERISEERKNSAAERQVNQEMIFAGQGGE
WVNPRSIIRLMEMGYERRLVVEALKRTKNNLDRSLDLLQRHSDELRANLPPIPPVDESLL
TTLQHLGFSEISARDALETTGNSFHKSLKFLLKSFPNESELLHVIETMTKVLEVQEPTSS
TNATANSTTPLVNLSNSKVNLLQTVLSEAKSEIESYNAFKRFNENLAENNNHYLNLPLDQ
EEQILIEYKRLLEG
Download sequence
Identical sequences Q9VBQ3
NP_651402.1.81976 FBpp0084254 7227.FBpp0084254 FBpp0084254 FBpp0084254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]