SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085012 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085012
Domain Number 1 Region: 180-263
Classification Level Classification E-value
Superfamily TPR-like 0.000000555
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085012   Gene: FBgn0039776   Transcript: FBtr0085650
Sequence length 550
Comment pep:known chromosome:BDGP5:3R:26291774:26311521:1 gene:FBgn0039776 transcript:FBtr0085650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADWRLMLLLGILLLVGGPANGEVYTALAEMEELLETESVLITNLEGYIRVQEDKLNFL
KNKMDEYQREHSDASHDITAYVSNPINAYLLTKRLTTDWRQVENLMEHDVGTDFLQNITQ
YRSLLKFPSDEDLNGAAVALLRLQDTYQLDTSSVARGKLNGIQYSTEMSSDDCFELGRQS
YVNHDYYHTVLWMNEAMARMLEEPTNHTQSFTKADILEYLAFSTYKEGNIESALTMTNEL
LQLLPHHERANGNKRFYEKEIAQQLQLRKMKGDDGTDEMPKSDLPVAKSDPAIFDMTERR
AYEMLCRGELKPSPSDLRSLRCRYVTNRVPFLRLGPLKLEEVHADPYIVIYHDAMYDSEI
DLIKRMARPRFRRATVQNSVTGALETANYRISKSAWLKTQEDRVIETVVQRTADMTGLDM
DSAEELQVVNYGIGGHYEPHFDFARKEEQRAFEGLNLGNRIATVLFYMSDVEQGGATVFT
SLHTALFPKKGTAAFWMNLHRDGQGDVRTRHAACPVLTGTKWVSNKWIHERGQEFRRPCD
LEEDHGEFAI
Download sequence
Identical sequences Q9VA69
NP_733371.1.81976 7227.FBpp0085012 FBpp0085012 FBpp0085012 FBpp0085012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]