SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085016 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085016
Domain Number 1 Region: 173-259
Classification Level Classification E-value
Superfamily TPR-like 0.000000317
Family Tetratricopeptide repeat (TPR) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085016   Gene: FBgn0039779   Transcript: FBtr0085654
Sequence length 527
Comment pep:known chromosome:BDGP5:3R:26315798:26317724:1 gene:FBgn0039779 transcript:FBtr0085654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDRHCLYIGIFQLIIWVGVANGEFYSSVDSMQDLAQVEEELLNATRSYVESQQKQLDFY
RRYVEQIKREHEWATSQLKLDDYLGHPLHAFRLIKRLVRDWDSLIFEPILANNAREEFRA
FVEVLSRDLGYPDQSELQGAIKGLARLQKVYNLATSDLADGIIGGLNYGSDLRWRECYEI
GVQLFDLGEYQRSLEWLQVAFILLRNSPREEKDADHYLSDIREYASMANFELGNPKKAAR
LLSQILESQPTHSAQQTQKYLESRVPGKNVQETKPSWFSNYTRLCQGRRLPEERSGDPLR
CYLDGKRHAYFTLAPLQVEPVHLDPDINVYHGMLSSKQILSIFEEADKEEMVRSAVAGSG
GEGTVRDLRVSQQTWLDYKSPVMNSVGRIIQFVSGFDMAGAEHMQVANYGVGGQYEPHPD
YFEVNLPKNFEGDRISTSMFYLSDVEQGGYTVFTKLNVFLPPVKGALVMWHNLHRSLHVD
ARTLHAGCPVIVGSKRIGNIWMHSGYQEFRRPCNLTSDSYKSLAYRD
Download sequence
Identical sequences Q9I7H5
FBpp0085015 NP_651801.1.81976 FBpp0085015 7227.FBpp0085015 FBpp0085016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]