SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085032 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085032
Domain Number 1 Region: 178-260
Classification Level Classification E-value
Superfamily TPR-like 0.0000922
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085032   Gene: FBgn0051015   Transcript: FBtr0085670
Sequence length 525
Comment pep:known chromosome:BDGP5:3R:26471828:26474273:-1 gene:FBgn0051015 transcript:FBtr0085670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSKWLLPVRVLLTYQVLLLLLRQAKGEESHCTSVAGMVKLLDLEAQLIDNLEDYAVEL
EKKLQTVRRSITSLRLENDKARSSTEEYLSNPLNSFSLIRRMNRDWIIWQLYMDDPVGIS
QVERIQELREHMPTHTDVEEAVTALDRIQSTYGLKVPEISHGFLNGKQYNVSLTVLDTYA
MGQILFDQKNYLAAASWIYQSVVLMEAFSMAAPLEISKNEVRMVYAETLLKLNQHADALK
VVNIALTDNPHDIKLLLKKSEIETMIRTGTNNAPPVKVQATGVPTAYQIGCRGQFPPSAD
SKLYCLYNRTTSPFLILAPLKMELVGLDPYMVLYHDVLSPKEIKELQGMATPGLKRATVY
QASSGRNEVVKTRTSKVAWFPDGYNPLTVRLNARISDMTGFNLYGSEMLQLMNYGLGGHY
DQHYDFFNKTNSNMTAMSGDRIATVLFYLTDVEQGGATVFPNIRKAVFPQRGSVVMWYNL
KDNGQIDTQTLHAACPVIVGSKWVCNKWIREREQIFSRPCLKKRM
Download sequence
Identical sequences Q8T5S8
7227.FBpp0085032 FBpp0085032 NP_733395.1.81976 FBpp0085032 FBpp0085032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]