SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085033 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085033
Domain Number 1 Region: 175-260
Classification Level Classification E-value
Superfamily TPR-like 0.00000359
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085033   Gene: FBgn0051013   Transcript: FBtr0085671
Sequence length 534
Comment pep:known chromosome:BDGP5:3R:26469489:26471602:-1 gene:FBgn0051013 transcript:FBtr0085671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGYFIRCLLVMLFHSTLVLGHRPLEKSHSLSLVTMVPLLELEKKLIDNLENYTNALEQKL
EIIRSQLLVIRAENEKGRRNAISYLSNPLNGFSIIRRLHQDWINWRKYMEQPVGIWQLKA
FYSWKDELPTERDLWDACEGIARIQSTYDLKVGDFINGNINGKQYNDSMSTADILSVGAY
LFMKNRPSDAIQWLQEVPQRLQEELLIQPRHLPIKEVDALRLLAEAQIKDQNYSEALPLL
HNCLKLQPHDARVLRLWKKTTDFIENQPDQSPTENKKRNVPIANAFKLSCNGPLESSTRL
HCFYNFTTTPFLRLAPLKTEQIGLDPYVVLYHEVLSAREISMLIGKAAQNMKNTKIHKER
AVPKKNRGRTAKGFWLKKESNELTKRITRRIMDMTGFDLADSEGFQVINYGIGGHYFLHM
DYFDFASSNHTDTRSRYSIDLGDRIATVLFYLTDVEQGGATVFGDVGYYVSPQAGTAIFW
YNLDTDGNGDPRTRHAACPVIVGSKWVMTEWIREKRQIFIRPCLPKAKGTSTKS
Download sequence
Identical sequences Q9VA50
NP_733394.3.81976 FBpp0085033 FBpp0085033 FBpp0085033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]