SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085047 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085047
Domain Number 1 Region: 165-280
Classification Level Classification E-value
Superfamily TPR-like 0.00000000354
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085047   Gene: FBgn0039783   Transcript: FBtr0085685
Sequence length 542
Comment pep:known chromosome:BDGP5:3R:26335805:26337936:-1 gene:FBgn0039783 transcript:FBtr0085685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFWRLVLLGMLYLSLSFGQLRENNAQQRFARSVVNMDDMLNLEDDLVSNVEKLAEALAR
KAKTIKWGVFKMMKRRQEYKSSMEIFANPIDTFSLIRHMQSNWLMWLLYLETPVGQEELF
FVDSRMPLLPKYFDFIDAAEGIRKMQATYQMFSSDIAKGLLDGVQYNSSLKPIDCLAIGL
HLMNNSRWYAAEQWISASIEAYDQKSSQTDMELLRGPKLADLCRILGQVQMKQRNHEGAL
QAYQVALKLSPHDPEIYEEYRILEKRDLTLSDIEPIEQDKDNSHERLVLPPCCSGRCQVP
RNLSNLYCVYNHVTSPFLQLAPIKTEILSIDPFVVLLHDMISQKESTLIRTSSKEHMLPS
ATTDPDASDDETQVDTYRTSKSVWYSSDFNDTTKKITERLGDATGLDMNSTEFYQVINYG
LGGFFETHLDMLLSEKNRFNGTSDRIATTLFYLNEVRQGGGTYFPRLNLTVFPQPGSALF
WYNLDTKGNDHMGSLHTGCPVIVGSKWVMSKWINDMGQEFTRPCVESSLSSNEVLSAERL
II
Download sequence
Identical sequences Q9VA61
NP_733378.1.81976 FBpp0085047 7227.FBpp0085047 FBpp0085047 FBpp0085047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]