SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085048 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0085048
Domain Number - Region: 170-260
Classification Level Classification E-value
Superfamily TPR-like 0.000233
Family Tetratricopeptide repeat (TPR) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085048   Gene: FBgn0051014   Transcript: FBtr0085686
Sequence length 540
Comment pep:known chromosome:BDGP5:3R:26329387:26331371:-1 gene:FBgn0051014 transcript:FBtr0085686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRLSIILSLLCVFPVNGDYYSAISELERLLDVEAFIVEKFDEYLERAQQEQENLKRFLD
QIDEQQNDRGDLEEYFGNPINAFITIKRLVHDWKFNVFDPVFDSSNFETYKNNLSDSLEK
INFKGPTQEDLHGATRALLRLQNMYQLNTDHLASGVLHPGEKNALGTSLSASDCFELGKN
LCEIKEYSYGSEWLLEARKRLHGKPLGFISPNVSDVEILEHLSSAFNGLGNLKLAYKLNN
EILDKKPDHEEALKNKILYEGQLARERSFAPRKQVELPQIAEKEQKESYKLYTQVCRGEL
HQSPREQRNLRCWLYHQGVPYYRLSPFKIEQLNVDPYVAYVHEVLWDSEIDTIMEHGKGN
MERSKVGQSENSTTSEVRISRNTWLWYDANPWLSKIKQRLEDVTGLSTESAEPLQLVNYG
IGGQYEPHFDFVEDDGQSVFSWKGNRLLTALFYLNDVALGGATAFPFLRLAVPPVKGSLL
IWYNLHSSTHKDFRTKHAGCPVLQGSKWICNEWFHVGAQEFRRPCGLSSDEGKFLHLKDI
Download sequence
Identical sequences Q9VA63
FBpp0085048 NP_733376.1.81976 FBpp0085048 7227.FBpp0085048 FBpp0085048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]