SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085050 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0085050
Domain Number - Region: 166-255
Classification Level Classification E-value
Superfamily TPR-like 0.001
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085050   Gene: FBgn0039780   Transcript: FBtr0085688
Sequence length 537
Comment pep:known chromosome:BDGP5:3R:26322473:26326048:-1 gene:FBgn0039780 transcript:FBtr0085688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLVLLVGLIFLLAQGSLASDYFSSITGLEDLLHTEQYLTRELRSKVNAIQTALQQLES
ELSSIEKEHTMAASDTENYLTNPVNVYRLMKRLHTDWSLMEGRVQLMAEEMNFNATREYG
LSYPSQEDVEGAALALVRLQSTYKLDVAQVAQGILNGVKYGSDMSWQDCFELGQQLFEME
DYNNTKVWLRESMERLRRQTSHAPSHLAPTSGPDTVTLNKMEATAKSLFQLGDFDTAFEL
SQRVLQFDPKRIRNWHLGDKGTAPPEDIDDVYLPKHSDSYSLSQEFAKYEKVCRGEVHPI
VRQELRCRYSRGNHPYRFLAPLKLEEHSLDPYVATFHDILSPGKISQLREMAVPRMHRST
VNPLPGGQLKKSAFRVSKNAWLAYESHPTMVGMLRDLKDATGLDTTFCEQLQVANYGVGG
HYEPHWDFFRDPNHYPAEEGNRIATAIFYLSEVEQGGATAFPFLDIAVKPQLGNVLFWYN
LHRSLDKDYRTKHAGCPVLKGSKWIGNVWIHEVTQTFARPCDVFRDHEVSLEYEIIK
Download sequence
Identical sequences Q9VA64
FBpp0085050 FBpp0085050 7227.FBpp0085050 FBpp0085050 NP_733374.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]