SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085051 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0085051
Domain Number - Region: 166-245
Classification Level Classification E-value
Superfamily TPR-like 0.000367
Family Tetratricopeptide repeat (TPR) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085051   Gene: FBgn0026190   Transcript: FBtr0085689
Sequence length 535
Comment pep:known chromosome:BDGP5:3R:26317535:26321875:-1 gene:FBgn0026190 transcript:FBtr0085689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAKCVLFLVLQVLSCHGEFFSSTSGLAKLFETEVVLLAELQNYVNEINQHAEALQSEI
DAIRVEHLNAADGIDDYLNNPVNAFRLIKRLHSDWETFEGSVTADSSRSNYLDTMASLKE
NLSFPSQDDFVGSAIALTRLQQTYQLDVAELASGILNGVKYGTAMSWQDCFVLGQHLYAL
RDYNHTVPWLQQSMQLLGEQSYGSESASLDFMEAVVEYHREMGAHESALSLVNHVLSIEP
DQRSHLLEARQQLEELITDGDKNGLLHLTARRPGDYHESREFRMYEQVCRGELAPLPSKQ
RNLRCRLRKSRLGYAPFKLEELHLDPLVVQLHQVIGSKDSDSLQKTARPRIKRSTVYSLG
GNGGSTAAAFRTSQGASFNYSRNAATKLLSRHVGDFSGLNMDYAEDLQVANYGIGGHYEP
HWDSFPENHIYQEGDLHGNRMATGIYYLADVEAGGGTAFPFLPLLVTPERGSLLFWYNLH
PSGDQDFRTKHAACPVLQGSKWIANVWIRERNQDNVRPCDLERGQEISLHYRDFD
Download sequence
Identical sequences Q9VA65
FBpp0085051 FBpp0085051 NP_524594.2.81976 FBpp0085051 7227.FBpp0085051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]