SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085420 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085420
Domain Number 1 Region: 234-521
Classification Level Classification E-value
Superfamily TPR-like 7.59e-65
Family Tetratricopeptide repeat (TPR) 0.00012
Further Details:      
 
Domain Number 2 Region: 54-320
Classification Level Classification E-value
Superfamily TPR-like 2.28e-47
Family Tetratricopeptide repeat (TPR) 0.000000000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085420   Gene: FBgn0261403   Transcript: FBtr0086084
Sequence length 1059
Comment pep:known chromosome:BDGP5:2R:1194756:1216986:1 gene:FBgn0261403 transcript:FBtr0086084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVEQTRINMQSQGQSHQLPSAAHILLDQNPNSTGSNLVVKQNDIQSLSSVGLLELAHRE
YQAVDYESAEKHCMQLWRQDSTNTGVLLLLSSIHFQCRRLDKSAQFSTLAIKQNPVLAEA
YSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQ
YNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAI
HHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYE
QGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLN
NLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQ
PTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIQS
YRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDIRMKKLVSIVTEQLEKNRLPSVHPHHSM
LYPLTHDCRKAIAARHANLCLEKVHVLHKKPYNFLKKLPTKGRLRIGYLSSDFGNHPTSH
LMQSVPGLHDRSKVEIFCYALSPDDGTTFRHKISRESENFVDLSQIPCNGKAADKIFNDG
IHILVNMNGYTKGARNEIFALRPAPIQVMWLGYPGTSGASFMDYIITDSVTSPLELAYQY
SEKLSYMPHTYFIGDHKQMFPHLKERIIVCDKQQSSVVDNVTVINATDLSPLVENTDVKE
IKEVVNAQKPVEITHKVAELPNTTQIVSMIATGQVQTSLNGVVVQNGLATTQTNNKAATG
EEVPQNIVITTRRQYMLPDDAVVYCNFNQLYKIDPQTLESWVEILKNVPKSVLWLLRFPA
VGEQNIKKTVSDFGISPDRVIFSNVAAKEEHVRRGQLADICLDTPLCNGHTTSMDVLWTG
TPVVTLPGETLASRVAASQLATLGCPELIARTREEYQNIAIRLGTKKEYLKALRAKVWKA
RVESPLFDCSQYAKGLEKLFLRMWEKYENGELPDHISAV
Download sequence
Identical sequences Q7KJA9
7227.FBpp0085422 FBpp0085420 FBpp0085420 FBpp0085421 FBpp0085422 NP_523620.1.81976 NP_724406.1.81976 NP_724407.1.81976 FBpp0085420 FBpp0085421 FBpp0085422 FR274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]