SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085431 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085431
Domain Number 1 Region: 3375-3548,3588-3768
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.1e-45
Family Protein kinases, catalytic subunit 0.091
Further Details:      
 
Domain Number 2 Region: 780-948,985-990,1104-1308,1365-1574
Classification Level Classification E-value
Superfamily ARM repeat 1.84e-26
Family Armadillo repeat 0.041
Further Details:      
 
Domain Number 3 Region: 16-105,156-195,241-276,319-356,384-493,677-915
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000013
Family HEAT repeat 0.064
Further Details:      
 
Weak hits

Sequence:  FBpp0085431
Domain Number - Region: 1794-1983,2043-2053,2083-2408,2575-2634,2661-2682,2874-2916
Classification Level Classification E-value
Superfamily ARM repeat 0.000144
Family MIF4G domain-like 0.062
Further Details:      
 
Domain Number - Region: 2704-2732,3030-3067
Classification Level Classification E-value
Superfamily TPR-like 0.000317
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085431   Gene: FBgn0053554   Transcript: FBtr0091528
Sequence length 3803
Comment pep:known chromosome:BDGP5:2R:1065506:1138553:-1 gene:FBgn0053554 transcript:FBtr0091528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVIENVPVNTFRNYLNILNDSSSKDELKLKATQELSEHFEMIMQSPAYPSFLDNSLKIF
MRILQDGEPQFIQENTMQHNLSKDVMLVATATVLAMNRLGTFVSCRALLDSGSQLHLIHP
YLHISFNLRRRNRSTGVGDFSFDTHEMIHRLPITESLRQHVKTIITMMLKILKTDNEENV
LVCLRIIIELHKHFRPSFNSEGMVEIPKERLDESHALEVIVTDLCGPFFYKPEACNKAPV
KCYIQLFLGFVKEIYTNLPNHLTSIFETSNDVWVTDLKDLNLEVLLSESYSVRTIHVEKA
LDSNSQQQIIRVDDEELIDDIIRDSRCFNSSAKLLHAFAKVSPIKSLFSSSGRAKVSIEK
GPSSVPTKRLNLMKNCPKEAAHLRKELLIAARHIFATDLRQKFIPSIEQLFDEDLLIGKG
VTLDSIRPLAYSTLADLAHHVRQSLNIDVLIKAVNLFSKNVHDESLAVGIQTMSCKLLLN
LVDCLRHHSETEPQRSKALLSKLLKVFVKKFETIAKIQLPLIIQKCKGHAFSGALVNSSG
NASLSHINAPDLKDDISNIQVSASGSQWIYSVNVAEFRSLVKTLVGGVKTITWGFFNSKF
QLTDTKLANHEKIFGPEIVCSYIDLVYYAMEALDIYTINVNPNQQRTSGLISRSKEEKEV
LEHFSGIFLMMHSQNFQEIFSTTINFLVERIYKNQSLQVIANSFLANPTTSPLFATVLVE
YLLNKMEEMGSNLERSNLYLRLFKLVFGSVSLFPVENEQMLRPHLHKIVNRSMELALISE
EPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLEGLNRLQSGFHKQHMRDLFVELCL
TVPVRLSSLLPYLPMLMDPLVSALNGSPTLISQGLRTLELCVDNLQPDFLYDHIQPVRAA
LMQALWKTLRNQDNAALVAFRVLGKFGGGNRKMMVEPQALSYIINDKPTISIVTYFQEYE
TPIDFPVDEAIKSAFRALGSNSTDQFYRRQSWEVIRCFLAAFISLDDEKHMLLKLFTHVD
FVENKIMNWSTFQHKAGNETVRETHQTALIGMLVASATKDLRDSVCPVMAAVVRHYTMVA
IAQQAGPFPQKGYQATHGIDPMILIDALASCMGHEEKELCKPGIACMGIILDTATNIMGN
KDRACKLPIIQYLAEKMVSLCYDRPWYSKVGGCQAIQFLCKHMSLRALFQNLFNFLKAFM
FVLMDLEGDVSNGAIEITKSYMKSMLEICLTPINECYKNIDLKDLQAKATYEVIHELVRH
ITSPNTIVREESMVLLKHIGTIQSKTVSEVMDPHKDVLADIIPPKKHLLRHQPANAQIGL
MDGNTFCTTLEPRLFTIDLTNTYHKLFFHELLTLSEAEDATLAKLDCYKNVPNLIPLRTS
ALRALAACHYISDIGYKEKIINIIFKVMESDKSELQTTAFHCMKHFITGVTLEKEKVQSA
MRPLLLKLGDHRNLSIPAIKRLSYFTQIFPQMFNEKLSEQILQHCSKIMEIFVSEYKSTS
PNVNFFASSKGGEYEQKIVILIEMFFYISASVKYIEKLCQLVLKTEKNLMIEASSPYREA
LIKFLQRFPTETVDLFLTESLMIDPQWNRLFIYLLKHETGVSFRAVIKSSRYNNLIHYLN
THTEFPEALKYEIQHQAVLIIFTLMESDDQWIPTRQDIVDALKNCWQNYLSTLSSEDVLC
DLWHLIGKILLHYFSNNTNDIELLFQLLRALCFRFIPDVYFLRDFLQHTVAQSFTVNWKR
NAFFYFVENFNNSFLSEELKAKIITAVIIPCFAVSFDKGEGNKLIGAPPTPYQEDEKNIV
SVFINKVFDPDKQYDDAVRIALLQLACLLVERASQHIHDGDANNKRQGNKLRRLMTFAWP
CLLSKSSVDPTARYHGHLLLSHIIARLAIHKKIVLQVFHSLLKGHALEARSIVKQALDVL
TPAMPLRMEDGNTMLTHWTKKIIVEEGHAMQQLFHILQLIIRHYKVYFPVRHQLVQHLIN
YMQRLGFPPTASIEHKKLAVDLAEVIIKWELHRIKDDRETKTDGTEEELIQESSVKRSGI
DLVETRKKSFDIIRETTVQGKCVMLLKMAMRPEIWPQPFDIKLNWLDKVLATVETPHHNL
NNICTGIDFLTFLTTILSPDQLVSIIRPVQRGLSLCIIHQNTRIVRLMHMFLTRIMAIFP
PDTQHKHEDLDLLYTAVSKMIAENLTSYEKSPQPNASSLFGTLMILKACTTNNASYIDRI
LVQFIRVLNHLTRDHINTIGGNTVISQSPDSNALPLELLVLSLELIKNRIFVMSVEIRKL
FIGTILVSLIEKSTEVKIIKCIIKMLDEWIKTKEPNVMTQVPSIREKSALLVKLMQNVEK
KFTDEIELNIQFLEIINFIYRDEILKQTELTNKLEGAFLNGLRFQNPNVRSKFFEILDSS
MRRRLHDRLLYIICSQAWDTIGSHYWIKQCIELLILTANTMMQIQCSNEQFKIPSITSVI
PVNSSETQENSFVSFLSSHSESFDIIQTVDDKDDVYDIDLNADRKEDCQQILPNRRVTLV
ELVYKQAEFLEANRNIRTDQMLVATSQLCHIDTQLAQSVWLSMFPRIWSIFTEDQRCNIT
KELIPFLSSGTNVNQKDCHPSTLNTFVESLTKCAPPIYIPPNLLAYLGKSHNLWHRAILV
LEDMAVNQSMQSKDIDGGENQFSDLDVQQSNNIFDSLSKMYSSMHEEDLWAGLWLKFAHY
PETNIAVSYEQMGFFEEAQGAYDLAMTKFKQDLSNGVVNTYVNSELLLWENHWMRCAKEL
NQWDILLDYAQTNKDKNMFLILESSWRVPDWNLMKIALAKTEQCYLKHYGFKINLYKGYL
SILHQEERQTGNIERYVEIASSLCIREWRRLPNIVSHIHLPYLQASQQIMELHEASQIHQ
GLAQSRNNSLHDMKAIVKTWRNRLPIISDDLSHWSDIFTWRQHHYQIITQHLEQQSDQGS
TMLGVHASAQAIISFGKIARKHNLTGVCQETLSRIYTIPSVPIVDCFQKIRQQVKCYLQM
PSTSGKNEINEALEVIESTNLKYFTGEMNAEFYALKGLLLAQIGRSEEAGKSFSVAAQLH
DGLTKAWAMWGDYMEQIFLKERKITLAVDALICYLQASRNQIESKTRKYIAKVLWFLSYD
NNTKILISTLEKHVAGIPPSYWLPWIPQLLCCLEQFEGDVILNLLSQIGRLYPQAVYFPI
RTLYLTLKIEQREKHKTAEQAVKSSCSNIDGTTLSFGRGASHGNIPSINPIKATPPMWRC
SKVMQLQREVHPTILSSLEGIVDQMVWFRESWTEEVLRQLRQGLIKCYAIAFEKRDTVQH
STITPHTLHFVKKLGSTFGIGIENVPGSVTSSISNSAASESLARRAQVTFQDPVFQKMKE
QFTNDFDFSKPGAMKLHNLISKLKTWIKVLETKVKKLPTSFLIEDKCRFLSNFSQKTAEV
ELPGELLIPLSSHYYVRIARFMPRVEIVQKNNTAARRLYIRGTNGKIYPYLVVLDSGLGD
ARREERVLQLKRMLNYYLEKQKETSRRFLNITVPRVVPISPQMRLAEDNPNSISLLKIFK
KCCQSMQVDYDMPIVKYYDRLSEVQARGTPTTHTLLREIFSEIQWTMVPKTLLKHWALKT
FLAATDFWHFRKMLTLQLALAFLCEHALNLTRLNADMMYLHQDSGLMNISYFKFDVNDDK
CQLNQHRPVPFRLTPNVGEFITHFGITGPLSAAIVATARCFIQPNYKLSSILQTILRDEI
IALQKKGFRECKLIEGSEDRYSDGNCMEHSVNIVNSAVDIIMTRFNKISYFDSIENKKIS
VLVQSATNIDNLCRMDPAWHPWL
Download sequence
Identical sequences 7227.FBpp0085431 FBpp0085431 FBpp0085431 FBpp0085431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]