SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085479 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085479
Domain Number 1 Region: 90-201
Classification Level Classification E-value
Superfamily TPR-like 1.66e-20
Family Tetratricopeptide repeat (TPR) 0.0032
Further Details:      
 
Weak hits

Sequence:  FBpp0085479
Domain Number - Region: 243-298
Classification Level Classification E-value
Superfamily NE0471 N-terminal domain-like 0.0157
Family NE0471 N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085479   Gene: FBgn0033083   Transcript: FBtr0086146
Sequence length 396
Comment pep:known chromosome:BDGP5:2R:2548155:2549623:-1 gene:FBgn0033083 transcript:FBtr0086146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQMAAQKAWTDEERLELAAQLDAELDAFIDGLEKKRYEEGWPEDRWQEEMDKHPFFMKR
APQPGDDVHPMFEGLQKLKYDPEENTRDELALNYKEDGNFYMKHKKFRMAIYSFTEGIKT
KTDNPDVLAVLYNNRSAAHFFIKNYRSSLSDAQRALFYKPDYTKARWRSAQCAYELERFD
LCTQMCEELLEVDVDNEVAIALLHKNKMKKLEIERNQRKEAAEAKRRLTRFHRLRDAIEQ
RAIKFDDQKVGKKDVLSEELLYPKFLPLEDHPVHLDEDGSTLIWPAAFSYPEFLYSDFYQ
QLPETTTMRDCLATLLTEKLPYDKAHNYRLGNVHVYYENRKVGCVHKVDEEKQLAEIIAE
KGFFVSGGALLFYVVHKDSRVEQEFINERRRPMVYS
Download sequence
Identical sequences A1Z6M6
FBpp0085479 7227.FBpp0085479 NP_001260729.1.81976 NP_525106.2.81976 FBpp0085479 FBpp0085479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]