SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085676 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085676
Domain Number 1 Region: 25-128
Classification Level Classification E-value
Superfamily TPR-like 0.00000901
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Weak hits

Sequence:  FBpp0085676
Domain Number - Region: 451-522
Classification Level Classification E-value
Superfamily TPR-like 0.0794
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085676   Gene: FBgn0034467   Transcript: FBtr0086481
Sequence length 580
Comment pep:known chromosome:BDGP5:2R:15573111:15575583:-1 gene:FBgn0034467 transcript:FBtr0086481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSIVEMPRANLEEALPPWMKIDWSDEVLHDIYRDWGTYYSRRRRENFALHYLNKALALE
PTDHMTLYKRCQSKRKAAQMLGALDDSRAAAKLARSKDGEEKAIINLDICDVLYELNQFE
NSKAEMHNNMRVFIGNKRKSFEQRQLVVDGVIKDVTGEAMSAFFTKNLKTVSIVHDLIKE
RERVDNRPLWKRLKEQGKCDVQSIPEVPEEMLSPMEIARRKRAFNIFHQSYINDSWIDVL
FMKMLCKNPNLLLPQCKESSYFLQQLSSKQYEIVRKFMKMLQSRSPLYLVNYLKYGNKAM
SDKYREAYLFRVQYQTHRNMNHALKEIRALRKAKKVQQLAKFVEELMGTYVVLKTARVMC
WKFEFLNEVYNTMALTLAEQLRVPKGFTPYGSNAILKLLRLPVERVKDFVPVTFGDRAPE
PEGNDPATTRAKRLTARLEHRMVFAKYSIEKCYLLHQISQSYLDQGRHSECTYNARKAIK
ESKNCNSNLWKFLSVVQIVKANAILHKLEQTKEALEDALPIAHFLKSSELILFIENCMAC
NTEDSINKRATLMQARRVSKSESVATHSLVSGQDVDSQGG
Download sequence
Identical sequences A1ZBP5
7227.FBpp0085676 FBpp0085676 NP_611441.1.81976 FBpp0085676 FBpp0085676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]