SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085689 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085689
Domain Number 1 Region: 25-347
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 4.05e-37
Family Tricorn protease domain 2 0.03
Further Details:      
 
Domain Number 2 Region: 259-415,465-541
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.23e-18
Family WD40-repeat 0.012
Further Details:      
 
Weak hits

Sequence:  FBpp0085689
Domain Number - Region: 771-808,865-988
Classification Level Classification E-value
Superfamily TPR-like 0.00104
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085689   Gene: FBgn0034452   Transcript: FBtr0086501
Sequence length 1366
Comment pep:known chromosome:BDGP5:2R:15374549:15379241:-1 gene:FBgn0034452 transcript:FBtr0086501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFEKILYKYEEPHGIGDVYFIWQKALLATTGTDGSVALYNRQGQLVQRIILSGLCSGFA
WDQEGDLLGIITSGSPNITLWDYNSQEKISVETGLRDPLTCILWSKQQQLLAVGTGRGNL
AIYNHSSGKRPTPVLGKHSKRITCGAWSAQNLLALGSEDKSFSLSNEDGDTVRVVQLRDA
PTDMYFAEMANDERIAGDNAISMIIGKRTLFLYYLPEPENPTELGFQSRYGSLMQHKWFG
DGYILLGFSNGHVVAISTHPKDVGQELWQVKNHKDSLTGLAYCPTLDIVASCGDDSIKIH
SITNLQETERIITVPDHAGVQMIDWSPDGQLLAVTTNHGTVYIYVTKLPHLFAVSAPRIV
LLSSLAEVSIYVYAPDKTKSLPFRLPLEGEPTFMAVGPYNFATGIEKHVWFYDLGKSLGE
EPRPLSERDFPRSVESMKLNADYCAALCPPQLILQAIAADNPNCKDKLQAVFPTALPNMP
SDAVITCFALSQELLIFATDIGHLVFYSLEKWDSCTIYRHSMGIRQLFMDIEGTKVIFID
DHSQGYVFLPVVEEALLIPDIPKQCLGCLWDLTQPNIFISYDARIVNTHVFVRHSVQGTH
TLMVGESKLNPGQFPLLLCGGEMALHIDGGQYATQSLSTHVVNPSNSQAANLQMLLKLRN
YDEAYKLCKQMNQSSAWREFGEQAISDLEPDIAIRAYRQLGDAALVNALSELRYVEDLDM
LIGCCCTLLAQYDQAKEHMLKGVYTRAALDLCRDLLQWDQALLLAHKNDPQEVPYIAREY
AQQLEFNGNYTDALYHYEKGYKEDLINSKETETDALMDSSPEYEEHVRLCKMGIARTSIR
AGDFRRGIQYAVELEDQQLLFDCAELLATVGHLTEAAGLYERGGFYDEACGHYIALKMWN
KANNILPKVKSTKLHAAYAKAKENDGHYEEAIRSYRIAGDLDACVRIYLDHLCDPHAASE
IVLESRSMDSAKLLAKFYQKIGDVEQALQFLVICGCVEEAFALAQRHNKLRRHGELLERY
ENAKSSDYLALAHYFEGEKYTLLAGKYYFLAREFTKALRFLLKASAFNNEEQVSLSLAID
CVATSNNEQLATQLIEFLLGEVDGVPKDPRYLFRLYMARKHYKDAAKTAVIIANQEQIAG
NYKSARDLLYSMYQELRRNNLSVTAEMRHQFILLHRYTLVRIHVKLGNHLLAAKLLVQVA
ACISQFPEHIIPILTSTVIECHRAGLKKSAFTYASTLMRPDYRNQLDPRYAKKIESIVRK
APKGIKQLRDEIDGETMECPICDSNLANMEVTCYSCKTTLPICIATGQHIIKQLMTSCPQ
CDFLCFRAEMENILSENGECPMCGENVAPEQLLDVEDIRPYILAAS
Download sequence
Identical sequences A1ZBM3
7227.FBpp0085689 NP_611426.1.81976 FBpp0085689 FBpp0085689 FBpp0085689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]