SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085842 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085842
Domain Number 1 Region: 51-175
Classification Level Classification E-value
Superfamily FKBP-like 6.48e-23
Family FKBP immunophilin/proline isomerase 0.00033
Further Details:      
 
Domain Number 2 Region: 193-348
Classification Level Classification E-value
Superfamily TPR-like 5.2e-22
Family Tetratricopeptide repeat (TPR) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085842   Gene: FBgn0034368   Transcript: FBtr0086661
Sequence length 397
Comment pep:known chromosome:BDGP5:2R:14517420:14519403:-1 gene:FBgn0034368 transcript:FBtr0086661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTEKSSSSSFEDLTNAEDTKDIRKVAAEEAASGDGAPPASVSGDGQKAEEEDAEEECDI
LGNKQLIKRTIKKAPQDSFRRPIRGELVTVNFTGKLDNGTVVENELNFQCHVGDYEVIQG
LDMVLPMLQVGEVSQVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDIKYEEFA
DLKSFEILRKYGTRKKERANFFYKRSEFTTAIHLYRRALDFLDNRDGDPDSEFDKEDLEL
SNSDTQTLLEDRLIVYNNLAMTQIKIAAYDAALQSVEHVLRCQPNNSKALYRKGRILEGK
ADTQGAIKLLQKVATLEPENRAVQSDLARLFIKARREEHNEKEMYQKMLGQAKKMEQNTA
TRQKQPLVDNSKLKLLGYLMGTILIGVAGVAIYRYKY
Download sequence
Identical sequences Q7K3D4
NP_001286579.1.81976 NP_001286580.1.81976 NP_001286581.1.81976 NP_611353.1.81976 FBpp0085842 FBpp0085842 FBpp0085842 7227.FBpp0085842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]