SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085923 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085923
Domain Number 1 Region: 59-321,505-583
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.19e-47
Family WD40-repeat 0.0037
Further Details:      
 
Domain Number 2 Region: 339-451
Classification Level Classification E-value
Superfamily TPR-like 2e-23
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085923   Gene: FBgn0000057   Transcript: FBtr0086744
Sequence length 628
Comment pep:known chromosome:BDGP5:2R:14039209:14041565:1 gene:FBgn0000057 transcript:FBtr0086744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDELYRVKYSSSRYQRQHTPLNASSLHWQRQQYGHELDEMLRRRLLASPAYVDRLEQE
AVLVGHEGCVNCLEWTTDGMWLASGSDDYRVMIWDPFRKKLVHVIRTKHLGNVFSVKFLP
KTNNSIVATCAADKFIYVYDINDPNETLFSCICHFSRAKRLATAQDSPHVFWSAGEDGCI
LQLDIREPHRCRPEEGIGVRLLNLHDQLENTEAKCLAINPRRTEYLAVGTNDPFARVYDR
RKLPSTNGNGLSACVAYYAPGQIVKNISRNIVHEPRGITYLTFNGNGTELLVNIGCEHVY
RFDLNHAEPPVFYDLPAFTSTLVHEEEPVKMPHRSRSLPTEIEVYKKEGNDFLENGKLVD
AIDAYSAALAKYPQGEVLYLNRATALMRRGWFGDIYAALRDCHEALRLDPSYVKAHFRLA
RALLELHRPQDADQCLQALIQRFPDFANNHGVLMLNKDIKENRRQSKSPEAPELQPVEVD
DGFRYLRLKNAEYDLRSTARDYMQRYVGHCNVTTDIKEANYLGSQGEFIAAGSDDGNMYI
WEGDTGKIRAVYRADSAIVNCVQPHPSICMLATSGIDHNIKIWSPCAASAEERPNLVADV
TRFVEDNQEKMRLDPFELHTRNAYCFNN
Download sequence
Identical sequences Q7K7W5
FBpp0085923 FR689 NP_001286563.1.81976 NP_611296.2.81976 FBpp0085923 FBpp0085923 7227.FBpp0085923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]