SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0086683 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086683
Domain Number 1 Region: 47-187
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000128
Family Tetratricopeptide repeat (TPR) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086683   Gene: FBgn0050075   Transcript: FBtr0087555
Sequence length 195
Comment pep:known chromosome:BDGP5:2R:10263426:10264182:1 gene:FBgn0050075 transcript:FBtr0087555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPNDKKGFKAAKNDKFSTHALLNENDNDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWMR
RMRYHDAQRAFEKAITRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKMRQSRCVCYVM
KELRLLTINNPSALALCQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISKRI
TELEDTNQMLSQLSI
Download sequence
Identical sequences A1Z9Q7
NP_725390.1.81976 FBpp0086683 FBpp0086683 FBpp0086683 7227.FBpp0086683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]