SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0086749 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086749
Domain Number 1 Region: 481-637
Classification Level Classification E-value
Superfamily TPR-like 1.26e-22
Family HAT/Suf repeat 0.057
Further Details:      
 
Domain Number 2 Region: 205-486
Classification Level Classification E-value
Superfamily TPR-like 1.57e-20
Family HAT/Suf repeat 0.028
Further Details:      
 
Domain Number 3 Region: 90-202
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000542
Family HAT/Suf repeat 0.02
Further Details:      
 
Domain Number 4 Region: 646-724
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000569
Family HAT/Suf repeat 0.091
Further Details:      
 
Domain Number 5 Region: 23-78
Classification Level Classification E-value
Superfamily TPR-like 0.000000024
Family HAT/Suf repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086749   Gene: FBgn0033859   Transcript: FBtr0087623
Sequence length 883
Comment pep:known chromosome:BDGP5:2R:9481154:9484068:1 gene:FBgn0033859 transcript:FBtr0087623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTKTIKSLNLEINFEVEDVPYEEEILRNAYSVKHWLRYIDHKAKAPNNGVNMVYERALK
ELPGSYKIWHNYLRTRRKQVRGKIPTDPMYEEVNSAFERALVFMHKMPRIWMDYGAFMTS
QCKITRTRHVFDRALRALPITQHGRIWPLYLQFVRRFEMPETALRVYRRYLKLFPEDTEE
YVDYLQEADRLDEAAQQLAHIVDNEHFVSKHGKSNHQLWNELCDLISKNPHKVHSLNVDA
IIRGGLRRYTDQLGHLWNSLADYYVRSGLFDRARDIYEEAIQTVTTVRDFTQVFDEYAQF
EELSLNRRMEQVAANEAATEEDDIDVELRLSRFEYLMERRLLLLNSVLLRQNPHNVHEWH
KRVTLYEDKPAEIISTYTEAVQTVQPKQAVGKLHTLWVEFAKFYEANGQVEDARVVFERG
TEVEYVKVEDLAAVWCEWAEMELRQQQFEAALKLMQRATAMPKRKIAYYDDTETVQARLH
RSLKVWSMYADLEESFGTFKTCKAVYERIIDLKICTPQIIINYGMFLEEHNYFEEAYRAY
EKGISLFKWPNVYDIWNSYLTKFLERYGGTKLERARDLFEQCLDQCPPEHAKYFYLLYAK
LEEEHGLARHAMSVYDRATSAVKEDEMFDMYNIFIKKAAEIYGLPRTREIYEKAIESLPE
QNMRHMCVKFAELETKLGEVDRARAIYAHCSQVCDPRITADFWQTWKEFEVRHGNEDTMR
EMLRIKRSVQATYNTQVNMMAAQFLSTNNGAAADAGAGAGPDAMRLLEEKARQAAAESKQ
KPIEKAASNIMFVRGETQGGAKDKKDTVVNPDEIDIGDSDEDDEEEDDDEENEMTNENQA
SAAVTKTDEEGLVMKKLRFEQKAIPAKVFGSLKPSNQGDSDGE
Download sequence
Identical sequences A1Z9G2
FBpp0086749 FBpp0086749 NP_610891.1.81976 FR707 7303287___KOG2047 7227.FBpp0086749 FBpp0086749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]