SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0086897 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086897
Domain Number 1 Region: 202-530
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.84e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000129
Further Details:      
 
Domain Number 2 Region: 55-180
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.96e-27
Family Anticodon-binding domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086897   Gene: FBgn0002069   Transcript: FBtr0087784
Sequence length 531
Comment pep:known chromosome:BDGP5:2R:8767824:8770675:1 gene:FBgn0002069 transcript:FBtr0087784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEDKEQVANGEQVSKKGAKKLAKAAKKAEQKAENASTAAANNAGGDSAEDHAAGRYGLS
EMIQSKDKRSERNFVPVSELSGQVGKGLVWVRGRVHTSRAKGKQCFLILRQQSSTVQCIL
AVGDVISKQMVKFAGNIPKESIIDIQAKPVAVSSKIESCTEQSLELSVEQIFVISQAKAQ
LPLQIEDASRPENADDAEGLNIRVNQDTRLDNRVLDLRTPANQAIFRLEAGVCRLFRDIL
TEQGFTEIHTPKIISAASEGGANVFTVSYFKDSAYLAQSPQLYKQMAIAADFDKVYTVGA
VFRAEDSNTHRHLTEFVGLDLEMAFKYHYHEVLHTIGNTFTSIFKGLRDKYAKEIESVGQ
QYKVDAFKFLEPPLILQFADGVAMLREAGVETGDEEDLSTPNEKLLGRLVKAKYDTDFYI
LDKFPLAIRPFYTMPDPNNPVYSNSYDMFMRGEEILSGAQRIHDPEYLIERAKHHGIDTS
KIAAYIESFRYGCPPHAGGGIGMERVVMLYLGLDNIRKTSMFPRDPKRLTP
Download sequence
Identical sequences Q7K0E6
FBpp0086897 FBpp0305104 NP_001260930.1.81976 NP_001260931.1.81976 NP_476609.1.81976 FBpp0086897 7227.FBpp0086897 FBpp0086897 7303387___KOG0556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]