SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0087091 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087091
Domain Number 1 Region: 183-231,410-489
Classification Level Classification E-value
Superfamily SET domain 3.01e-20
Family Viral histone H3 Lysine 27 Methyltransferase 0.033
Further Details:      
 
Domain Number 2 Region: 223-273
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000314
Family MYND zinc finger 0.02
Further Details:      
 
Domain Number 3 Region: 69-138
Classification Level Classification E-value
Superfamily TPR-like 0.00000928
Family Tetratricopeptide repeat (TPR) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087091   Gene: FBgn0027495   Transcript: FBtr0087983
Sequence length 573
Comment pep:known chromosome:BDGP5:2R:8028110:8030834:1 gene:FBgn0027495 transcript:FBtr0087983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVYDVSDDLIKKLQDWKLIGIISGKFNELKENHRKVDFVMRALIDFKYIEKIFLNVTLR
EDKCNKRSVEFRMLGNEQFSLKNRNYFQALELYNKSICYAEPNSEHLSIGYANRSAVLFE
WKRYRQCLDNIKLARQANYPARLSHKLDKRERDCQQLLDQQPPDVVPYEFKLSFEPHAQV
PFIADCLELRETAAEGRFVVTNRDLAVGDLVSVEEPFCSTLLTPMRYIRCATCKRENYLT
LIPCDSCCSTMFCSEECKSIAMQTYHRYECPIIDFLNRMFNKIHCIALRTTLVALNIFPS
IEELIDFCEQEQNQDKCAFDLNYNELTPEEHYRAIHGLVTNQHLRSVSDLFQRSVVCAVL
KHFIIEYTPVKEYLGGEEGVNFFTDLLFRHLQTSPSNMHGIDLVEQVNETKDDQTHSSGA
YAFLSLINHSCAPNTVRIYEGTKAYMFVLRPIKAGNVLYDNYGAHFAICSKEQRLKRLSL
QYRFDCKCEGCELNYPMFGMMPHKATVPSVTDDTELALSSYNYDFAVSNYRKYCDFLTQY
GDDYPCEQISSAEECLKMALHIMADAVPLKAKM
Download sequence
Identical sequences Q7KMH5
7227.FBpp0087091 FBpp0087091 FBpp0087091 FBpp0087091 NP_610730.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]