SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0087297 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087297
Domain Number 1 Region: 161-377
Classification Level Classification E-value
Superfamily TPR-like 6.78e-29
Family Tetratricopeptide repeat (TPR) 0.0097
Further Details:      
 
Domain Number 2 Region: 71-176
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000104
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087297   Gene: FBgn0033578   Transcript: FBtr0088202
Sequence length 486
Comment pep:known chromosome:BDGP5:2R:7023433:7026766:1 gene:FBgn0033578 transcript:FBtr0088202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYEPGTEQINCNGRLIELPTLEVVRPAPKMPSDANIDWLLHIYFTRREFTRCRRLIEREL
NRHLNPEYLYFVQGLIDREEGNHIEALRHLQKSAELNPRNIETYKEIGRTLYIMGRFSQA
LGVFREAEQRSSRQDHEIYHYLGELLYRAATTQSQKDVASQQQDEARTYFELAVQSGRKL
ESYVRLAELYRKDKQYQKAIEILENCLHLTPENSEVLIEISVLYLKINETQKAHDRLAEV
VSIERKCSPKGLLAFGAILQSRNDIDGALSKYSQIANAEPEIAELWNNIGLCFFKKQKFI
VAISSLRKSVWLSPLNYNALYNLSLIYIASEQYASAFHTLAAAINLRKDNAECYMLLGLC
LRKLDDMENAFVALERASSMATGQQGAGRNPLVVLNFALFCYETGRLALSTEQYNRFMSQ
AQDLLLPTEYKFQATKLKSLLRISNQGNGILLDSADMGESDLGHNRATELLPDELPLEVN
AVVSQN
Download sequence
Identical sequences A1Z8E9
FBpp0087297 7227.FBpp0087297 FR731 NP_610636.1.81976 FBpp0087297 FBpp0087297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]